SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015059 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015059
Domain Number 1 Region: 188-306
Classification Level Classification E-value
Superfamily EF-hand 6.41e-36
Family Osteonectin 0.01
Further Details:      
 
Domain Number 2 Region: 276-368
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.53e-22
Family Thyroglobulin type-1 domain 0.00088
Further Details:      
 
Domain Number 3 Region: 127-173
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000998
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015059   Gene: ENSXMAG00000015014   Transcript: ENSXMAT00000015079
Sequence length 413
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556661.1:800430:842776:1 gene:ENSXMAG00000015014 transcript:ENSXMAT00000015079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMETVRTVACLYLLVGVSLQVDAKSGKETARVGNFMEDEQWLSTISQYSRKTKHWNRFRD
DDYIRNAEETTGSDETVDTTKDPCQNVKCSRHKVCVAQGYQRATCINRKKLEQRVKQSGQ
QELHESSCKPCPVAASSPVCGSDGHNYASECKLEQQACLTGKDLRIMCSGFCPCATAPAA
NTDIRRESCTGQDLADLGDRLRDWFQLLHGNAKQNNSGKPGAGATSVLEKSLVASCKDSI
GWMFSKLDTNGDLYLDQTELAAINLDKYEICIRPFFNSCDSYKDGKVSTAEWCLCFWREK
PPCLAELERIQVQQAAKKKPGTYIPSCDEDGYYRKVQCDQSRGECWCVDLHGEMMGSRVH
GNPDCDEVTGYSGDFGSGVGWEDEEEKEADDNGEEAEEEEEEEGEADDGGYIW
Download sequence
Identical sequences M4AKR5
ENSXMAP00000015059 ENSXMAP00000015059 XP_014331508.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]