SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015441 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXMAP00000015441
Domain Number - Region: 28-125
Classification Level Classification E-value
Superfamily Tropomyosin 0.000916
Family Tropomyosin 0.014
Further Details:      
 
Domain Number - Region: 174-307,361-396
Classification Level Classification E-value
Superfamily YWTD domain 0.00968
Family YWTD domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015441   Gene: ENSXMAG00000015411   Transcript: ENSXMAT00000015463
Sequence length 400
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556669.1:801588:808390:1 gene:ENSXMAG00000015411 transcript:ENSXMAT00000015463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLLLLSLGLTLGSVQSQGSSQDAFIIQYLERRLVQMEERLSLCEQNTVSATQKTYDLS
SEVRGYLSTLSSLRSEVKSQVDSVSVRVDRVERELEYLENKIPTQSNIEMEEALLEQQIK
AVELEQLKKKAKINVVNDCNTVLSQVKSLKIVKKSGDPNGCWFKDPSEGSNKVYLFSGFR
NNTILEYKSLKSFTKTSTPPANEVQLPFYWQGTGHVIYNGFLYCHKADTPNEILKVDLLN
GTVVDRTLLPGAGRLPVYSLNPNTYLDMAVDELGLWVIHADLEYGGNLVITKLDKVSLAV
EYTWDTQCRSSDAEGAFLICGTLYVVYNTRYGGRSTIQCLYDIHDTIHSNESPVMFFPKR
YTSHSSIHYHPGDKQLYAWDDGYQTIYKVETRSNAQVTSQ
Download sequence
Identical sequences M4ALU7
ENSXMAP00000015441 ENSXMAP00000015441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]