SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016125 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016125
Domain Number 1 Region: 126-242
Classification Level Classification E-value
Superfamily EF-hand 6.45e-29
Family Osteonectin 0.027
Further Details:      
 
Domain Number 2 Region: 215-307
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 8.24e-26
Family Thyroglobulin type-1 domain 0.00062
Further Details:      
 
Domain Number 3 Region: 66-112
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000887
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016125   Gene: ENSXMAG00000016081   Transcript: ENSXMAT00000016149
Sequence length 357
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557802.1:9922:17783:1 gene:ENSXMAG00000016081 transcript:ENSXMAT00000016149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVEEPGTWTPSKPFDQALDPAKDPCLKIKCSRHKVCVAEDYKTASCVSQRRVSFKDANLQ
PSAGSKCKPCPVVHPSPVCGSDGHTYSTKCKLDYQACITGKKISVKCPGMCPCPPQPEQG
SAEKKVCSESDLKEVVSRLRDWFRVLHENGNHQRVKIQKPEKHKFDVGTSPICKDPLGWM
FSRLDTNFDLQLDQSEIKSLYLDRNEPCSDAFFRSSDTHPDKVITSSEWCTGFQRYTDSP
CKAELSSISKKQAGKKLLGQYLPSCDEEGYYRPHQCHSSSGQCWCVDRFGNEVASSRTHG
PADCGVILESSGDLGSGDSLFPDDDEDSFVLNDQAGMDDEDDEDEDDDDDENDEYLS
Download sequence
Identical sequences M4ANT0
ENSXMAP00000016125 ENSXMAP00000016125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]