SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016137 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016137
Domain Number 1 Region: 346-654
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.42e-53
Family Rhodopsin-like 0.0013
Further Details:      
 
Domain Number 2 Region: 49-286
Classification Level Classification E-value
Superfamily L domain-like 8.16e-36
Family Ngr ectodomain-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016137   Gene: ENSXMAG00000016086   Transcript: ENSXMAT00000016161
Sequence length 702
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556661.1:3017003:3037180:-1 gene:ENSXMAG00000016086 transcript:ENSXMAT00000016161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFERMVANVLIMLMIKMAAASMPGSETDLKHGYGAGFPELIQNPCHPVGFGVRAIPPNIS
SNTWCLVVKQTQIREIQQRSFANLHHLRKLVILQNNILQSIGASAFAGLPRLSDVCISEN
LSLETIKAFAFSDLPELAEIEITKSKHLRSIHPDAFRNIVNLRRLTISNTGLRIFPDLSK
IQSAARGFLFDLQDNINIETVPANAFRGLCTKPIEEIRLTRNGIKEVASDAFNGTKMYRL
LLSGNKQLAHISPDAFVGSSELVVLDVSQTAVSSLPDSILGGLKKLFAESAYRLKELPIV
QRYTKLHIAKLTYSSHCCAFKNMHRNRSKWTSMCSHPEAKTIPAFFREHCSNSTSVSCSP
APDNFNPCEDIMSPILLRILIWIISVLALLGNAVVLLVLLGSRSKLTVPRFLMCHLAFAD
LCMGIYLLVIATVDMLTHGRYYNHAIDWQTGFGCKAAGFLQVFASELSVFTLTAITVERW
HTISNAMRLDRKLRLRHACIIMTTGWSFSLLAALLPTVGVSSYSKVSICLPMDVESVVSQ
VYVVSLLVLNILAFFCVCGCYLSIYLTYRKPSSAPAHADTRVAQRMAVLIFTDFVCMAPI
SFFAVSAALKLPLITVSEAKLLLVLFYPINSCSNPFLYAFFTHTFRRDFFLLTARFGLFK
TQAQIYRTETSSCQQPTWTSPKSSRVIYSLANTLSLDGKQEF
Download sequence
Identical sequences M4ANU2
ENSXMAP00000016137 ENSXMAP00000016137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]