SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016369 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016369
Domain Number 1 Region: 439-699
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-53
Family YWTD domain 0.000000063
Further Details:      
 
Domain Number 2 Region: 231-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000929
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 3 Region: 353-431,700-752
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000121
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 27-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000196
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 5 Region: 145-186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000563
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 6 Region: 269-309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000458
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 7 Region: 189-227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 8 Region: 103-146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 9 Region: 67-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 10 Region: 314-350
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016369   Gene: ENSXMAG00000016312   Transcript: ENSXMAT00000016393
Sequence length 861
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557110.1:90354:108464:-1 gene:ENSXMAG00000016312 transcript:ENSXMAT00000016393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTSAPRILLLLLLMWLQHCGTVHGTKTECEANQFQCGNGRCIPAVWQCDGDEDCTDGSD
ENSCVQKTCADVDFVCRSGQCIPKRWHCDGEPDCEDGSDESVEICHMRTCRLNEFSCGPG
TTLCIPIFWKCDGERDCDKGEDEVNCGNVTCALNEFTCASGRCISKNFVCNGEDDCGDGS
DEVDCVPSSCAPSEFQCGNASCIPASWVCDDDVDCQDQSDEAPTRCGRHPTPPAKCLPSE
MQCGSGECIHKKWRCDGDPDCKDGSDEANCPVRSCGPDQFKCDDGSCILGSRQCNGIRDC
ADGSDEINCKNLTQCNGPEKFKCRSGECIEMSKVCNKIRDCPDWSDEPIKECNVNECLLN
NGGCSHICKDTVIGFECDCTPGLQLIDHKTCGDINECMNPGICSQICVNLKGGYKCECHN
GYQMDPATGVCKAVGKEPCLIFTNRRDIRRLGLERKEYTQIVEQQRNAAALDADFNQQTI
FWADLGQRAIYSTVLDKRGDVGVHKKVIDNVQTPLGIAVDWIYKNLYWSDLGTKTISVAN
FNGTKRKVLFNTGLKEPASIAVDPLSGFLYWSDWGEPAKIEKSGMNGADRQVLVATDIQW
PNGITLDLIKGRLYWVDSKLHMLSSVDLNGDNRNKVLQSADYLAHPFALTVFEDRVFWTD
GENKAIYGANKFSGSDVITLASNLNDPQDVIVYHELIQLAGTNWCTEKSENGGCSFMCLP
APQINKHSPKYSCVCPAGQELAADGHRCRPVTDSSSEDGSEALTQPKEANVSTSIQVDST
ARGSAAAWAILPVLLLAMAGAGAYLMWRNWQLKNQKSMNFDNPVYLKTTEEDLNIDITRH
GANVGHTYPAISIVSTDDDLS
Download sequence
Identical sequences M4APH4
ENSXMAP00000016369 ENSXMAP00000016369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]