SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016612 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016612
Domain Number 1 Region: 8-156
Classification Level Classification E-value
Superfamily EF-hand 5.99e-47
Family Calmodulin-like 0.00000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016612   Gene: ENSXMAG00000016572   Transcript: ENSXMAT00000016636
Sequence length 160
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556818.1:848425:852576:1 gene:ENSXMAG00000016572 transcript:ENSXMAT00000016636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDAQQEARSYLSEEMLAEFKAAFDLFDTDGGGDISTKELGTVMRMLGQNPTREELDEII
EEVDEDGSGSIDFEEFLVMMVRLLKEDEAGKSEEELAECFRVFDKNGDGYIDRDEFALII
RSSGETITDDEIDELLKDGDKNSDGMLDFDEFLKMMENVQ
Download sequence
Identical sequences A0A087YNG2 A0A0S7KJK7 M4AQ67
XP_005806264.1.87360 XP_007571353.1.10163 XP_008411024.1.1237 XP_014825226.1.96476 XP_014869869.1.100837 ENSXMAP00000016612 ENSXMAP00000016612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]