SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016901 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016901
Domain Number 1 Region: 113-169
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000000000000017
Family Thyroglobulin type-1 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016901   Gene: ENSXMAG00000016870   Transcript: ENSXMAT00000016925
Sequence length 193
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556866.1:300555:308537:1 gene:ENSXMAG00000016870 transcript:ENSXMAT00000016925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDPEIPSQPLLGETVVNVGPPAQGQRSTRAYTVAGLTLLACVLIMGQAAIAYFLVNQKS
DIRDLQEQNNRMNVQMTNGGSASVPVRLHIPMSPAMEMMDTTMEEESSGTKKTTTPTTQC
QLEAAGVNPGPMPGFFPRCDKLGLYEPQQCFQGQCWCVSPADGQPIPGDKSCIRSAFSGN
LMTLNQKLDTEDA
Download sequence
Identical sequences M4AR06
ENSXMAP00000016901 ENSXMAP00000016901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]