SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016917 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016917
Domain Number 1 Region: 199-273
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.96e-21
Family Thyroglobulin type-1 domain 0.00029
Further Details:      
 
Domain Number 2 Region: 27-110
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.38e-21
Family Growth factor receptor domain 0.0000932
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016917   Gene: ENSXMAG00000016878   Transcript: ENSXMAT00000016941
Sequence length 285
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556667.1:4913593:4921076:1 gene:ENSXMAG00000016878 transcript:ENSXMAT00000016941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSYFLALRMIFLVASLTRRSGASGPVIRCEPCDIRARLLCKPLPKECAERVREPGCGCC
MTCALSFGQPCGVYTGRCSSGLTCQHQPGETKPLQALLEGRGVCVNATNRRPSVRPTPTY
PVNEVPDNTEAKDKEEKPSCPDLETSCNPAPPRPSLHPILSPAKSNAIRWDQQKATRICK
VEDLSGPVITDQLNISLETKQEPEYGPCRREIECILSTLKIMNILNPRGFRIPNCDKKGF
YKKKQCRPSKGRKRGFCWSVDKYGQPLPGLDGKEREVQRYNSESQ
Download sequence
Identical sequences M4AR22
ENSXMAP00000016917 ENSXMAP00000016917 XP_005796090.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]