SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016926 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016926
Domain Number 1 Region: 154-243
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.71e-21
Family Thyroglobulin type-1 domain 0.00021
Further Details:      
 
Domain Number 2 Region: 33-111
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.06e-19
Family Growth factor receptor domain 0.0000819
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016926   Gene: ENSXMAG00000016888   Transcript: ENSXMAT00000016950
Sequence length 247
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556667.1:4921102:4922971:-1 gene:ENSXMAG00000016888 transcript:ENSXMAT00000016950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEFSEKLTFVVAVVLAVMALGSSSPVVGPEPIRCAPCTQQKLSNCPAVSADCKQVLREP
GCGCCMACALEKGASCGVHTAHCGEGLRCTPRPGETRPLHALTRGQGVCTDDEGQEAGDE
VQEHGSAHYLLGLNLPSDHQDTAEMHESLKARVNAIRNKLVQQGPCHVELHAALDMIASS
QQQLGDKFITFYLPNCDKHGYYKPKQCESSLVGPPVRCWCVSSWNGKKLPGTSDLLADAH
CQQEVAL
Download sequence
Identical sequences M4AR31
XP_005796091.1.87360 ENSXMAP00000016926 ENSXMAP00000016926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]