SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016946 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016946
Domain Number 1 Region: 3019-3283
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-49
Family YWTD domain 0.00000529
Further Details:      
 
Domain Number 2 Region: 1271-1512
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-47
Family YWTD domain 0.00000534
Further Details:      
 
Domain Number 3 Region: 208-470
Classification Level Classification E-value
Superfamily YWTD domain 9.29e-41
Family YWTD domain 0.0000178
Further Details:      
 
Domain Number 4 Region: 3874-4147
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-38
Family YWTD domain 0.0000332
Further Details:      
 
Domain Number 5 Region: 2203-2459
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-38
Family YWTD domain 0.00000473
Further Details:      
 
Domain Number 6 Region: 1560-1824
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-35
Family YWTD domain 0.0000708
Further Details:      
 
Domain Number 7 Region: 1913-2150
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-34
Family YWTD domain 0.0000552
Further Details:      
 
Domain Number 8 Region: 544-781
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-34
Family YWTD domain 0.0000627
Further Details:      
 
Domain Number 9 Region: 81-96,131-199,464-520
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000879
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 10 Region: 1085-1132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000301
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 11 Region: 880-917
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 12 Region: 919-957
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 13 Region: 2804-2846
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000223
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 14 Region: 1085-1247
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000033
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 15 Region: 3406-3448
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000471
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 16 Region: 2845-2887
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 17 Region: 3660-3695
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000707
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 18 Region: 2722-2758
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000798
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 19 Region: 3447-3487
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000106
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 20 Region: 2963-3011
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000113
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 21 Region: 2548-2589
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 22 Region: 3617-3654
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 23 Region: 961-998
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 24 Region: 1833-1873,2159-2196,2457-2521
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000022
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 25 Region: 2513-2550
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 26 Region: 35-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 27 Region: 1-37
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 28 Region: 3538-3575
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000851
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 29 Region: 2889-2928
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 30 Region: 3573-3613
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000122
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 31 Region: 2680-2715
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 32 Region: 2930-2978
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000191
Family EGF-type module 0.022
Further Details:      
 
Domain Number 33 Region: 3367-3407
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 34 Region: 1001-1038
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 35 Region: 1044-1080
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 36 Region: 3331-3366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 37 Region: 3746-3783
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 38 Region: 3702-3740
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 39 Region: 836-874
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 40 Region: 2635-2672
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 41 Region: 3501-3534
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000864
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 42 Region: 2760-2804
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000995
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 43 Region: 3827-3866
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000121
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 44 Region: 2597-2632
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000301
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 45 Region: 4206-4240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.051
Further Details:      
 
Domain Number 46 Region: 794-836
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000519
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000016946
Domain Number - Region: 3789-3828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00012
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 1515-1559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000492
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 4150-4235
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0121
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016946   Gene: ENSXMAG00000016794   Transcript: ENSXMAT00000016970
Sequence length 4292
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557139.1:19699:55176:1 gene:ENSXMAG00000016794 transcript:ENSXMAT00000016970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPIHQFECRNGFCVPLAFVCDHWDDCGDNSDEQDCEYPTCKGNEFTCSSGRCIPQNWVCD
KSNDCGDFSDESGCDSDSRDCYPGEWGCPGSTACIPVDKVCDGKPDCPGATDETNTTAHQ
TCGLDRCSALSCEYLCHPSPQGGTCYCPDGFIVANDSRSCVDYDDCNIWGICDQLCEDRP
GTHHCSCADGFFLEQGHVCKANVSGGLPQLIFTNGGDVLMADIHGRFVRTLVPAQGKGYA
IGVAYNIRSNVVFWSDTNTKKVYSASYNGENIKEILTTAVPNVQNLAVDWINFKLYVLDA
TLDRIDMCDYDGGNRVTLVAENLETPHGLALDPTVGYMFFSDMGVSQEKTKLERAFMDGS
NRVEIIKSRLGTPTAITLDIITKRVYWSDSHFDTVETVTYSGLDRKIVLNGATQSPHPFG
MAVFENHVFFTDWTKMGVIRTNRFNGSNPTLLYRTANRPGHVVVSHSAVQPFVMNPCGRH
NGGCQHICVLSHRSDNGGLGFRCKCRYGYDLGSDRHSCFKIKDYLLVASSLAIRGIPLNL
SLQEDVTLPLTGLGSSFSGSAVEFDGNEEAVFYNDRSKGLIYKSNLNGTAQQILTGKTVG
IVDAMAYDWTSKVLFWTTSTYRAVVAFRVTDKSKKDIVTGLRYPKGIAIHPSAGYLFWSD
WYRPAVIMKAFPDGSNAVPLVNTTLGWPYGLALDYVMDRLYWVDSLLDQVGHISIEGTDR
KTFTSIGQITEPYSLTVYSDFLYISDTRTRAIFEMRKRDAGGSTMIRQGVTGILNIKAYS
ADLHGTFNSRCNSVPNGLCSHFCFPTPSLSRVCGCPYGMKLQANQRDCIKDDSVPPPDDC
GDYAFECDEGRCRPNSFRCDGIFDCVDKTDEANCTDTGSTCSPYAFTCNNKHCIYSSWRC
DGHDDCGDGSDEVNCPTRVPTTCGSSYFTCNNNKCISKNWVCDGDNDCGDGSDEQNCDST
ITTCPPGYFLCPDHRCISDFYVCDGDQDCLDGSDEKNCEFSCQSYEFACASGDQCISSYY
RCDGVFDCRDHSDEQNCPTRGPGLCHNDEFQCQTDGFCIPDEWECDGHPDCEDGSDEHNT
CPAVTCSSSYFQCTNKMCIPMSWLCDGENDCRDMSDEQNCPTPPFSCPSGQWLCPTDQVC
IDLGKVCDGQRDCPNGADESPICNQDDCALNNGGCTDGCIQGPFGAQCTCSPGFQLLNDS
KTCDDIDECLIPGFCSQQCYNERGSFRCHCSHGYLLEPDGRTCKVTDPHAAVLLVAQRSQ
ILANRLIMRPPLIRPVATGSNIVTVDFDRETSRIYWADAIQKKIWSAFQNGTEKREVFST
GLMVPESIAVDWVGRNLYWTDSDLENIEVSTLDGHYRKVLLNKNVTSPRGLALDPRNHTY
LMFWSDWGQNPRIERASMDGAMRQVIVSTKVYWPNGLALDYTTHRVYFADAYLKYIDYCD
YDGRNRHQVMASDLNLQHPHGMTIFEDSVYWSERYTGKVMSTNKFHGGNMTILFNNIYQP
MGIVMDHPVKQPAAINPCREHLCTQLCLLSTMRPRYYTCHCQSGWKLDSDQRTCIKDDSP
FLMVVRDTVIFGIPLDPTDPSNNAMAPISGITEGQDIDFDDKEQYVYWVQGTSSIWRIKT
NGSDRAQFAPAAYMGSPSGLAFDWISRIMYYTNPTSQTIEVIRVDGNEKYRKTLIASTGK
PEGAGKPFGIALDPVRGKLFWTDKGSDNGVPPKVGSADMDGSNLKNLYTTNLANIGFITA
DISTTKLYWGVSGSGVIECGTMDGVTRVTVVSGLSHPGGLTVYQNHLYYTDLDYEVLERV
DKDTGANMVVMRSGLSGLHALKVHARDNSAGTTNGCSTNNGGCPHLCLPKPENQKTCACT
TGFYPSHDGSRCEEYESFAVVSTSEYIRGFHINSSDHSEAMVPVGRSYYSTKNKVDLHIE
SGFVYWSEDSSYSSYRGIFRAKTDGGSFSRIINSGVGVGGIQGLAVDWIAGNLYFTNAFE
KETFLEIQSINSSYRMILVRSFEDQPRDLAVSPKLRYLFWTDGGQSPKIERALLDGTNRT
VLASESLASPRGLTVDYTNNFLYWTDDVLDMISRMAVDGTEREIIRYGSRYPSPTGLAIF
GNYMLWVDKKLDKLFQASKDPANTNQTEVIRDSLNGVMDVAVFDSHVQPTSANLVGFNPC
HEDNGRCQQLCFAIPEQQKPKCACAHGSLLSNGVTCGYGQDEFLVFTTDYTLNSLRLDST
DHSLPFPTVNLDYNVIALDFDYKERRIFYTQSKGLGRSVIGYITTTSITSPPVILASNLD
DPDGLAYDWIHKRLYFTDYATRNVQSIGLDGQNRSVIAHANRPRGIIVDPCYGYLYWTDW
GTPAKIERATLGGNFRTAIVNDSLITPNGLSIDYEERMLYWADASLYKIERATLNGENRE
VILQGVQYPFSMTVFQQDIFWTDWTERGVFRAGKDDGSGYTVLAQDLQYRPNDIHIYASS
KQEACVSFCQQFNGGCSDICVSGPVGPECQCPHEGNWYLANNGKDCIKDTGKRCQPEQFT
CLNGNCISARWKCDGFNDCNDRSDELERVCAFHTCSPLDFTCDNGRCVPMSYVCDYTDDC
GDNSDERGCAFPTCNPTVDFTCANGRCINSAYVCDGRNDCRDNVTSDEINCPDRVCPGGQ
IKCEHNNICIFPENLCDGYNNCGDNSDENPLFCGTTPAAGRTCAANQFSCDEGKCIPQSW
VCDSITDCTDKTDEPPSCEDIVKTCAAGEFTCTNGNCIPQSVVCDGNNDCWDNSDEAPEL
QCGERTCSSNQFTCPTWYPGHPRCVPLNAVCDGEKDCANAADELQNCPIRNCHMNEFACA
NGLCILIPYHCDRVNDCGDGSDELNCKYDTCSSSQFTCGNGACIPASYTCDGSNDCLDGS
DEADSLCVTLQPTCSPQQYMCSSGECIDLHKVCNGQKDCQDNSDEKGCGVNECLNTQVHQ
CAQLCTDTLTGYYCSCNPGYRLMPDGKACEDINECTTTPAVCSQICENSVGSFHCKCAPG
YIREPDGRTCRQNSGVPSYLLYSNRYYIRYLYVDGTKSGIAQQGLSNVVAVDYDDYEKWL
YWLDVGAGKIERMRFDGTGRETLVAHNIGGAEGLVVDWVGRKLYWVDSYYSSVHVMELDG
RYQKKLVTGEFKNGNDTYFISRPRAVAINPKYGWLYWTDWGDKAYIGRVGMDGRNISAII
TTKLEWPNALTIDYTTNKIFFADSHLNFLDYADMDGQNRHRAIAGTLPHVFAASLFEDWI
YWTDWNTHTLERAHKYTGEQRIIMGNNTHRPYDIRVHHPYRQPRSENPCSSHHLTCSHLC
LIAPGGQQASCECPDHFIGIALGFQIQCVADCSSTQFRCGDNEKCVPIWWKCDGQSDCGD
GSDEPQTCPPRYCRIGQFQCRDGNCTFPGFLCDGHPDCPDSSDEDAALCSDHRCEVNQFQ
CKNKKCIPVSWHCDGFTDCSDGSDEDAETCAQKTCRPGEFKCANGRCLPSSYVCDAQDDC
GDGSDEPFETCMGPEYKCDEDTEFSCKTNYRCVPQWARCDGTNDCLDNSDEEGCEELTCD
PLGDFRCDNHRCVPIRWKCDGADDCGDGSDERNCEPRSCTESEFRCDNAQCIPGNWRCDH
DNDCGDNSDERDCELLTCRPGFFQCDSGHCIPTALQCDGQADCLDLSDETSCPTRYPGGR
WCRPNQFQCANRLCVSPSWVCDGVDDCGDRSDEVLSLCLNVTCKMPSRFRCANGYCIYSG
LLCNMKDDCGDGSDEDEVLCREPTLAPCTLEQFKCTNGHCVALAYVCDHNDNCGDRTDEM
GCNFGQDRNCDEKLCQHVCTNLDGTGFICSCRTGYKVDPDSTYNCLDIDECKEYGTCPQV
CKNTKGSYDCECSSGYRKVGEGKMCEAEGAAPLLLLPESVRIRRFNLQAETYHDFLQEEE
RIMALDYDWDHNNTGFSMVYFTVAGKDSEPGAIKRAYIPSVDDGSNNIAAAVDLGIKYIT
TPDGIAVDWVGRNLYWADSRLKRLEVAMLDGRYRKHLVKTDLGYPSAVAVNPRLGMLYWA
DRGDVAKIECSWLDGQERKVLVADGLGWPTGLSIDFTNGDRIYWSDSKESRIESVLPSGE
QRRTAVFIGVDVRNPFSVCVFEDHVYWSTQEKGEVFRQDKFGQGDKVKLLTAGPWLTQIS
VYQQQRYNSMANAVKNPCKGTCSHLCLIRPGGYTCACPEGTNFITGSNTECDAGFDPPPT
MPPPCQCQNGGTCYFDDNKALCICPSAWKGDYCQTSVHNVVASSVGIAIGVTVLVVALLV
ALVYFCRKKSNIMERLQGSLPSMPSMPSMPSM
Download sequence
Identical sequences M4AR51
ENSXMAP00000016946 ENSXMAP00000016946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]