SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017363 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017363
Domain Number 1 Region: 191-296
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 7.85e-16
Family CRAL/TRIO domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017363   Gene: ENSXMAG00000017327   Transcript: ENSXMAT00000017387
Sequence length 311
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556800.1:802715:811082:1 gene:ENSXMAG00000017327 transcript:ENSXMAT00000017387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALRNHKILSSPAEQSEESEQKPLTPSRARPAPPSSLNLSGDRQMKKKVLAAPTLSLSLGG
SESITSDDLQSTFLSPSPEDAEDTTLDFDLDALETPSDSESLHFPLYDLDLEGNRREQIV
NFTEDVVDSEGTRWRCFTTGDPPQESRVNMSVLEPYLRVLSHGGYYGDGEDDIIVFSSCY
LPENSLENYQYVMDNLFRFVIGTLELMVAENYVIVYLCAGGQKEKLPGIGWLKECYTTID
RRLRKNLKGFYVVHPTWYIKIVVTIIKPFISSKFSRKLQFVNTLQELSLFIPTEHVQIPD
CVRQYDQNQSS
Download sequence
Identical sequences M4ASB8
ENSXMAP00000017363 ENSXMAP00000017363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]