SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017983 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017983
Domain Number 1 Region: 332-522
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.12e-48
Family CRAL/TRIO domain 0.0000268
Further Details:      
 
Domain Number 2 Region: 246-328
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 7.46e-22
Family CRAL/TRIO N-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 535-648,675-693
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.22e-18
Family Supernatant protein factor (SPF), C-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017983   Gene: ENSXMAG00000017937   Transcript: ENSXMAT00000018009
Sequence length 736
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556748.1:1094254:1121688:-1 gene:ENSXMAG00000017937 transcript:ENSXMAT00000018009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQKYQSPVRVYKHPFELVMAAYERRFPTCHLIPMFVNSDVVNEETSEDGSTNRIERRCA
LDVDAPRLLKRIAGVDYVYFIQKNTLNRKERTLHIESHNETFSNRVVVHETCCYSVHPEN
EGWTCFEQTASLDIKSFFGFESTVEKIAMKQYASSINKGKEIIEFYLRELESEGVTHVPR
WTCSSVSPALPAPNSLSASPPELQHPSAPAVSASQPADTKDGPAQEAKQDTGAPQADSLV
EILAGTPEDKLDADYIKRYLGDLTPLQESCLIRLRKWLQETHKGKIPKDEHILRFLRARD
FNMDKAREILCQSLTWRKQHQVDYLLETWSPPQVLQDYYTGGWHHHDRDGRPLYILRLGH
MDTKGLVRALGEESLLRHVLSINEEGLRRCEENTKVFGRPISCWTCLVDLEGLNMRHLWR
PGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDENTRKKFLIYAGNDY
QGPGGLVDYIDKEIIPDFLGGECMCEVPEGGLVPKSMYRTPEELENEDVRLWTETIYQSA
SIFKGAPHELVIEIIDAASVITWDFDVCKGDIVFNIYHSKRAPQQPRKDPLGAHGITSPG
VNNVQLIDKSWTLGQDYSMVESPLTCKEGESVQGSHITRWPGFYILQWKFHNMPACSATN
LPRVDDVLATLQVSSHKCKVMFYTEVLGSEDFRTACCDVQSLGSMTSLESSHSGFSQLSA
ATTSSNHSQSSSMISR
Download sequence
Identical sequences M4AU38
ENSXMAP00000017983 ENSXMAP00000017983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]