SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018154 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018154
Domain Number 1 Region: 75-273
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.83e-55
Family CRAL/TRIO domain 0.0000000698
Further Details:      
 
Domain Number 2 Region: 277-392
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 7.59e-36
Family Supernatant protein factor (SPF), C-terminal domain 0.00000377
Further Details:      
 
Domain Number 3 Region: 2-74
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 2.62e-21
Family CRAL/TRIO N-terminal domain 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018154   Gene: ENSXMAG00000018111   Transcript: ENSXMAT00000018181
Sequence length 428
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557211.1:53519:75549:1 gene:ENSXMAG00000018111 transcript:ENSXMAT00000018181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRVGDLSPKQAEALEQFRSKVQDILPQLPAQHDHFLLRWLRARNFNVQKSEAMLRKHL
EFRKHMKVDAIITDWQPPEVIEKYLSGGMCGYDREGSPIWYDVIGPVDPKGLFLSASKQD
FIKSKIRDCEMLQKECNLQSERLGRNIESITMIYDVEGLGLKHLWKPAIETYGEILQMFE
DNYPEGLKRLFVIKAPKLFPVAYNLVKHFLSEITRQKINILGGNWQEVLLKYIDAEELPA
IYGGKATDPDGDPRCRTRINHVGPVPPSYYVRDHVNVDYEHCLTVNRGSSQQMDFEILFP
GCVLRWQFACEGADIGFGVFLKTRKGEWKKASEMQEVIPSQRYNAHLVPEDGSLTCELPG
VYVLRFDNTYSIFQAKRVSYTVEVLLPDRLQSQREAQTNGTSEGTGEKSSEGTSEKSSDQ
LQDAQTRL
Download sequence
Identical sequences M4AUK9
XP_005813298.1.87360 ENSXMAP00000018154 ENSXMAP00000018154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]