SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018213 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018213
Domain Number 1 Region: 168-252
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.06e-24
Family Thyroglobulin type-1 domain 0.0000207
Further Details:      
 
Domain Number 2 Region: 31-111
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-21
Family Growth factor receptor domain 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018213   Gene: ENSXMAG00000018176   Transcript: ENSXMAT00000018240
Sequence length 259
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556748.1:1641488:1660804:1 gene:ENSXMAG00000018176 transcript:ENSXMAT00000018240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRGRGVTSTCWGLWTFGALSLAVLCLSDQAIRCPVCSDERLASCRLPESCEETVREPGC
GCCPTCALPKGAHCGVYSPRCGTGLRCYPPRGVERPLHSLMHGQGICTDEREVEENSAVD
RQEEIIPEHPNNSNIRCSPQDKRCIQKTMARHPLKTTNLRSNSGREETKPVLAPCRAELQ
RALDRLASNSRTHDDLFTIPIPNCDKNGDFHPKQCHPARDGHRGKCWCVDPKTGMRLPGP
LELRGDLDCHQLMTATLRD
Download sequence
Identical sequences M4AUR8
ENSXMAP00000018213 ENSXMAP00000018213 XP_005803103.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]