SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018309 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXMAP00000018309
Domain Number - Region: 234-427
Classification Level Classification E-value
Superfamily YWTD domain 0.00165
Family YWTD domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018309   Gene: ENSXMAG00000018276   Transcript: ENSXMAT00000018336
Sequence length 471
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557008.1:263642:266333:1 gene:ENSXMAG00000018276 transcript:ENSXMAT00000018336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLSFLSSSCFAVFSQSQGQASLSRSNDPNGRCVYSFAVVSPQESSCPGGSAKSEMDE
VLTRLTLLEALVSRLTARGEQGTASGGLRRSEENLQEAYAQVTRERNQLQLDQERLNAQV
RKLQGTVAELNRETERLRQRPCEQTHTSGGTLHENRPFGDPGYHFENTSYQEMKAEVKEV
PASRLLPEGSQLASSPKLSSNISSECGELLSVGDPVLHRKADTITGKYGVWLQDPDPRGP
YYTNKTVWRIDSVGKEIRQLFVYEDMDQFSKGFPMKVLVLPEPVESTGATMYRGSLYYQR
RRSRTLLRYNLTSESLASRLDLPHASFHGQHPYSWGGYTDIDLAADERGLWVIYSTGKAK
GAIVISQLDPASLEVRRSWETKIRKNSVGNAFMVCGRLYTVASYMTPNTSINYMFDTATG
EGQAVAVPFVNKYRYNSMVDYNHAQRKLYAWDNFHMVTYDVRLGQVGQGRS
Download sequence
Identical sequences M4AV14
ENSXMAP00000018309 ENSXMAP00000018309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]