SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018329 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018329
Domain Number 1 Region: 40-292
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.42e-37
Family Rhodopsin-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018329   Gene: ENSXMAG00000018297   Transcript: ENSXMAT00000018356
Sequence length 311
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556675.1:15555:17994:1 gene:ENSXMAG00000018297 transcript:ENSXMAT00000018356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYYEHVYLDFNDTGSGSGFWDDGENLEESCNVEHGMTAELHRVFLPVVYAIIFVLGITG
NGLVVVVLGCQRRSKCSLTDWYRLHLSVAVVRATGTNTGGLRQLLAHKAVYVGAWLPATL
LAVPDMVFARTQEGGEGATVCQRFYPEENAPVWVAVFHLQLVLVGLVIPGLVLLVCYCVI
VSRLTRPGPLGGQRQKRRAVRTTIALVLCFFICWLPYGAGISVDALLRLEVLPRCCRLEA
ALGVWLSVAEPMAFAHCCLNPLLYAFLGAGFKSSARRALTLSRASSLKILPRRRNGTSMT
PETESSSLHSS
Download sequence
Identical sequences M4AV34
ENSXMAP00000018329 ENSXMAP00000018329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]