SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000019391 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000019391
Domain Number 1 Region: 26-312
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.3e-23
Family Rhodopsin-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000019391   Gene: ENSXMAG00000019345   Transcript: ENSXMAT00000019419
Sequence length 320
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556675.1:3363849:3366035:1 gene:ENSXMAG00000019345 transcript:ENSXMAT00000019419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIPITFSSSPPNTAVFKRDTFTMALVKNLIVVLIWLVLTYINCTLAATFFRHQTFYADPR
YILFIHMVINDGIQLTVTFALFILSYIFYKINVSLCCFFVLVAVFTTRNTPVSLAGMAIE
RYIAICKPLHYSQICTVKRTYAVIGLIWFICVAPDITDLFVTLATEPISFFQHNSVFCLR
ESVFKDPILAQKRKAFDIIYFSCVFLTLVFTYLKILFAARALSTADTSAQKARNTILLHG
VQLAMCLLSYISPSVEIVLHVIFPGRILEIRFANYLIVYILPRFLSPIIYGARDKKFKKY
LRMDALRCSCKYKGKPVVPL
Download sequence
Identical sequences M4AY46
ENSXMAP00000019391 ENSXMAP00000019391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]