SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000019767 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000019767
Domain Number 1 Region: 89-416
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.32e-52
Family Rhodopsin-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000019767   Gene: ENSXMAG00000019720   Transcript: ENSXMAT00000019795
Sequence length 466
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556722.1:802309:803709:1 gene:ENSXMAG00000019720 transcript:ENSXMAT00000019795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLAAHQMAGTAMSALTTGVQYLGSNDASYDDLSADSSQSKNGFVLGTKEVIFTAIAPVF
PTNISGLALGNATAVESVEAPQCAENLADNLECFMILTPSQQLAIVILALTLGTFTVLEN
FMVLCVILHSQTLRSRPSYHFIGSLAVADLIGSIIFVYSFLDFHVLHRKDSPNVFLFKLA
GVIASFTASVGSLFLTAIDRYISIHRPMAYKRIVTKTKAVIAFLMMWTISIVISLLPLLG
WNCKRLGSVCSDIFPLIDRRYLMFWIGITSVLVLFIIYAYMFILWKSHHHAVRMLSRTSQ
RSVIIYTAEGAKVQTVRPEQARMDLRLAKTLVMILVALIICWGPLLAIMVYDLFGKVDDF
IKTVFAFCSMLCLLNSTVNPVIYAMRSKDLRRAFRNICHMWRGGSQTLDSSAESDWTSRS
MRAAAAAAAAAAGRAEKKRGRREKTEAKVSQVRVSGGTESSAAQPV
Download sequence
Identical sequences M4AZ72
XP_005801365.1.87360 ENSXMAP00000019767 ENSXMAP00000019767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]