SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000020110 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000020110
Domain Number 1 Region: 7-187
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.39e-38
Family Rhodopsin-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000020110   Gene: ENSXMAG00000020063   Transcript: ENSXMAT00000020138
Sequence length 188
Comment pep:novel scaffold:Xipmac4.4.2:JH560318.1:833:1396:-1 gene:ENSXMAG00000020063 transcript:ENSXMAT00000020138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSTFVRPAEFYLGGFYNIPHVKYYYVFLCFVYIMTVLGNGFLLSVIYLVKTLHSPKYIIV
FNLAFTDLCASTALIPKLLDTFLFNRRYIVYEACLAYMFFVLLFGGIQSWTLVTMAYDRL
IAICFPLRYHSIITTKAVVVILLCCWMFMVGITATLAGFINRLSFCSSIEIKSFFCDHGP
IYQLACND
Download sequence
Identical sequences M4B065
ENSXMAP00000020110 ENSXMAP00000020110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]