SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000020231 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000020231
Domain Number 1 Region: 26-270
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.56e-30
Family Rhodopsin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000020231   Gene: ENSXMAG00000020184   Transcript: ENSXMAT00000020259
Sequence length 271
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557705.1:53355:54167:1 gene:ENSXMAG00000020184 transcript:ENSXMAT00000020259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVNESLAGMDATAEQTPSRSLTIPAIMFVIGVIGNVIAIVVLRLSRKEQKETTFYTLV
CGLAVTDLLGTLLASPVTLFIYVNNNSLEGKLCQYSGFILLYFFLVQLSIVFTMSVERFL
AINHAYFYNEFVNQRLAALTLLAVYVSCLVFCALPVAGIGEVKVQEPKSWCFIDWQSNKT
TVRTFNLIYAGVNSVIVLATVFCNVMVCGALILMHRRFIRRTSLGTDPRRIAELRRRRNF
RRLAGVEIQMVVVLIGTSAVVLICSIPLVVS
Download sequence
Identical sequences M4B0I6
ENSXMAP00000020231 ENSXMAP00000020231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]