SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000020243 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000020243
Domain Number 1 Region: 6-351
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 9.15e-66
Family Rhodopsin-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000020243   Gene: ENSXMAG00000020196   Transcript: ENSXMAT00000020271
Sequence length 352
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556757.1:1612262:1613320:1 gene:ENSXMAG00000020196 transcript:ENSXMAT00000020271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDDDDYNYMLYLQNMNITEDPSHVVSEVVQLCAKKTVNMFGAKLIPVFYFVNFFLSYLG
NGLVLLIIFKYEKLTTVTNIFLLNLVLSNLLFASSLPFWATYHLSEWIFGEALCKMVSSA
YFIGFYSSILFLTLMTFDRYLAVVHALAACKRRKKKYAIISSVIVWCISISASVKELVLR
NVFVNSMQGKMCEESGLSASSMRVWRLVSFYQQFMIFFLLPLIMVMYCYVRITLRILSTR
MKEKCRAIKLIFVIIFTFFVCWTPYNLVCLLRAIRISAGETDEEESCSTKQNLDYAYYLT
RNIAYLYCCISPMFYTFLGKKFQSHFNKLVIEKIPCLSRHISFNSQSTRSTS
Download sequence
Identical sequences M4B0J8
ENSXMAP00000020243 ENSXMAP00000020243 XP_014325929.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]