SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000101 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000101
Domain Number 1 Region: 27-133
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-35
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000123
Further Details:      
 
Domain Number 2 Region: 209-305
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 7.59e-33
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000662
Further Details:      
 
Domain Number 3 Region: 365-467
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.96e-16
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000101   Gene: ENSXMAG00000000088   Transcript: ENSXMAT00000000101
Sequence length 467
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557556.1:25901:42232:1 gene:ENSXMAG00000000088 transcript:ENSXMAT00000000101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMSGHPPQRRQSNVGSLILSQQDNESLFNYLGRKCITLSSGVVQVYTAERNGSWNKRCCG
VACLVKDNPQRSYFIRVLDIREGKMMFEQELYNCFNGNLQRPYFITFAGDTCQVGLNFAN
EEETKRFHGALAELTVKRNRKTEKRRDPPNGPALPMATVDIKHPEISNSHRILNNAPMNS
LVHGSFPRRIKKEKVKKKKLTKADIGTPSNFQHVNHIGWNPNTGFDMNNLDPELKNLFDL
AGISEAQLKDKETSKAIYDFIEKNGGVEAVKNEVRRQAPPPPPPRGGPPPPPPPQHGSAP
PPPPPSRVVRGAPPPPPHSRPPVSAPPPXPSSSPYTSPRASPWSSPKLTAKKQTPPPGPA
TAPPPPPPPPPPGPPPPPSMEANGGEGKSALLSQIREGAQLKKVEQKERPVSTGGRDALL
DQIRQGVQLKARDDNSEPTSTDAAPTAGIVGALMAAMQKRSKAIHSS
Download sequence
Identical sequences M3ZD09
ENSXMAP00000000101 ENSXMAP00000000101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]