SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000179 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000179
Domain Number 1 Region: 96-188
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.31e-19
Family CRAL/TRIO domain 0.00079
Further Details:      
 
Domain Number 2 Region: 6-82
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.7e-18
Family CRAL/TRIO N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000179   Gene: ENSXMAG00000000183   Transcript: ENSXMAT00000000179
Sequence length 188
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH560133.1:818:6212:-1 gene:ENSXMAG00000000183 transcript:ENSXMAT00000000179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHLQAGLSPETLEKAKVELKENPETLHQDIQEVRDMIITRPDIGFLRTDDAFILRFLRA
RKFNHFEAFRLLAQYFEYRQQNLDMFKNLKATDPGIKQALKDGFPGVLSNLDKYGRKILV
LFAANWDQSRYTFVDILRAILLSLESMIEDPELQVNGFILIIDWSNFTFKQASKLTPSML
RLAIEGLQ
Download sequence
Identical sequences M3ZD87
ENSXMAP00000000179 ENSXMAP00000000179 XP_005817261.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]