SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000503 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000503
Domain Number 1 Region: 192-394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-51
Family DBL homology domain (DH-domain) 0.000000467
Further Details:      
 
Domain Number 2 Region: 2-231
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.63e-44
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 381-542
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-30
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 
Domain Number 4 Region: 634-764
Classification Level Classification E-value
Superfamily SH2 domain 1.18e-26
Family SH2 domain 0.00077
Further Details:      
 
Domain Number 5 Region: 792-860
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-21
Family SH3-domain 0.00084
Further Details:      
 
Domain Number 6 Region: 590-663
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000016
Family SH3-domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000503   Gene: ENSXMAG00000000476   Transcript: ENSXMAT00000000505
Sequence length 862
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556730.1:566133:622150:1 gene:ENSXMAG00000000476 transcript:ENSXMAT00000000505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYWRQCAMWLIGCNVLPANHRVTADTAQVFDLAQTLRDGVLLCQLLNNLKPHTINLKEI
NLRPQMSQFLCLKNIRTFLSSCCDVFGMKKSDLFESFDLFDVRDFGKVMDTLSKLSHTAV
AQQGGFKPFPLEESLKDEEIYNNLEDLIDENVPEDEDDLYAAVYGLEDEYAGGEIYEDLM
RTEQHAPLKQAEVDVRSCCLSEIKQTEERYTETLESIEKYFLNPLKKFFSAAEIDKVFVN
IPDLVKVHKSLMGDLQDSILNKNALNLYQIFISYKERLLIYGIYCSRVEIAIAVLDLICK
EKEDVRLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDAADKSNLKIA
LDAMKDLAQYVNEVKRDNETLREIDQYQRSIENLNQPLVTFGRPKGDGEVRLVSNVDKRK
QDRHIFLFDVAAIVCKRRGDNYEMKDILDLNFFKITNNPTSDREGKKWCYGFFVTHQQGH
MGFELCFKTKELKKKWLDQFEMAISNIRPEKANHNSHQFKMHTFERITSCSYCHLLLRGI
FNQGYRCQKCGLGAHKECLGRLGACGRTVSVSHLPADPVKLRPKENTAPPGPGLPRMIVI
RDYSGIPSPQCGPPLSIQAGDVIELMFADLHSSWWQGKILATSKTGFFPSDAVRPCPCVP
KPVDYSSQLWFAGLMERYQAEEELIDRGNSTYLVRHRSKDCNEYAISIKFNDKVKHIKIL
TKDGCFYIAESRLFKTVLDLVEYYKQHSLKEGFSSLDTTLQVPYRELSNGIMPKAITKVG
NVSSGGCGFVPPSFSPFWSVISPRIVGIAVARYDFSSRDTRELSLQQGDIIRIYTKMTNG
WWRGEVDGKVGWFPSTYVDEED
Download sequence
Identical sequences M3ZE61
ENSXMAP00000000503 ENSXMAP00000000503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]