SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001141 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001141
Domain Number 1 Region: 720-944
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-57
Family DBL homology domain (DH-domain) 0.000000225
Further Details:      
 
Domain Number 2 Region: 324-502
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.06e-42
Family Regulator of G-protein signaling, RGS 0.00000221
Further Details:      
 
Domain Number 3 Region: 944-1073
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-28
Family Pleckstrin-homology domain (PH domain) 0.0000475
Further Details:      
 
Domain Number 4 Region: 38-126
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-21
Family PDZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001141   Gene: ENSXMAG00000001109   Transcript: ENSXMAT00000001144
Sequence length 1414
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556911.1:193038:215447:1 gene:ENSXMAG00000001109 transcript:ENSXMAT00000001144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRQPTSTLDRLNSLTAGDSERRGPASQQREVTIDESSSKPGPGLVHRCVVVQKDQLGF
GFTVCGERVKLVQNVRPGGAAVKAGVHEGDRIIKVNGSPVSTMTHQEVVKLIKSGPYVAL
TLQGPPPSATSVPLEPLPSDSTPNQRSSLTGEGPPPPPPPLPSGLGSTPSQRITGPKPLQ
DPEVQKHASQILRKMLEQEEAELQGLMEEWLKSPSPSLEERIESAKRRAHQVRVKIQNQE
GTGSESVTNYIQAGEGRLSIDSSEGDLEVAFESPSSSPSLPFRTPYHRRQNSDTHTLSDT
GAKAQIISPEDEDEEGDGYAFNEMDGPFQDIELLKSRPMTVFMRYVFTQLLDPNPLLFYL
SVEAYLGSTPKDARALAPQICSHFLDPDAPLKIKVREEFLTEIENRLHAQEDIRGPLSEL
QQQVLPDIQDQIQDYRNKQMIGLGSLFGEGDLHQLDGDPLKEKHVVDRQVAALWEILSKH
EEDRSSPLASAVLLYLRHSGIKLRDSKVFLGLSTEKDKWLAFLKPKKPSSVKKEKDGEDK
KRNPILKYIGKPRSTSQSTFHVPLSPTEVRPGSVKNIIQQFENHTELPGEEEGDAVDPQR
LSSSSLGEEGMDSPTVSVRLGRSGSLKAQGEDRRRGTVSSGDSVPRSRSDVDMEDCEERE
QPGLRLLQHSASSSASSSSARSLENPTPPYTPRSRRRSVDSQLALLPDAAVLEDEVCDGQ
NWRDTVPPELLATLGPREVERQAVIYELFTTEVSHLRTLRVLDKVFYRKMRSVLNSEELA
CIFPNLPQVYELHASLCEEMKKRRESPIVQNIGDVMLAKVEGAAGNEFQEQASQLCCQQT
QALELIKNKKRKDPRFAQIIQECEASPQCRRLQLKDLLVSEMLRLTKYPLLLDKIIKYTE
GGSSDLPSLQRAQACCRGILKAVNEDVRETEHRQRLSQYQRRLDAAPQFKSLDLTTKRMI
HEGPLVWKIGKDKQIEIQALLLSDCMVLLQKGPDDRLLLRYPSRWMGGGGGVITDTKTSF
SPLVKLDSLLVRSVATDKKALYIISTKETQIYELAAGSPSEKDTWKDLLEKTIKASAPQS
NHGSLPASSPSLRSISPALTEVSNPPVHPEEEQSEFIGSHVSADDGMLGDRPTDQPEANS
SDEDRAVGVAEAALHDVETLRRLLLPDTDEDRRSHDTDSTPTNTMSNGNADGRQQDSLET
VLDLCLSEPEPGQPEAPPPESRQPSAKVVRRGKRIAAFAPDGTAGDVSLPSDLSSHSRGN
FFYLVMPLDQGESVTDDLPDPPTPTASHFPQPPQEVSSPQTQLEEKEEEEVVAACCTEFI
QSDSETTQQSHVIRNADEIFLTIEGLMSKLHKLKEIEKAHHKLLESLRDPSLSQESEDQP
CRSATVSRTPSMDRSSGDGKEGNPGDPRILSTGF
Download sequence
Identical sequences M3ZFZ9
ENSXMAP00000001141 ENSXMAP00000001141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]