SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001228 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001228
Domain Number 1 Region: 124-293
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.88e-48
Family CRAL/TRIO domain 0.0000374
Further Details:      
 
Domain Number 2 Region: 31-113
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.23e-20
Family CRAL/TRIO N-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001228   Gene: ENSXMAG00000001241   Transcript: ENSXMAT00000001231
Sequence length 345
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557013.1:148193:154429:1 gene:ENSXMAG00000001241 transcript:ENSXMAT00000001231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQHESISLSPPQADRATSAGHSWFPGPPPPMYSCTLTPELVAKAREELQEKPEWRLRD
VQALRDMILKEHPNLRTRLDDAFLLRFLRARKFDYDRALQLLLNYHAGRKTWPEVFQDLK
PSTVKHVLDLGFLTVLPRPDPNGRYILFLRPGKWKPNDYPFVDNVRALYLTLEKLIQPEE
TQVNGLVILADYTGVGMSQASNPGPFLAKKIVSILQDGFPIRIKAVNIINEPRIFKGIFA
IIKPFLKEKMAERYVLHGSDLRSLHRNILPSVLPEEYGGTAGRLDMSAWSRLLLDCEEEF
VVEFCQPDPLEGVVLPDSMLCEGEQAGGREEDGFRALRSQLYYCY
Download sequence
Identical sequences M3ZG86
ENSXMAP00000001228 ENSXMAP00000001228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]