SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002256 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002256
Domain Number 1 Region: 909-981
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.94e-19
Family TB module/8-cys domain 0.00073
Further Details:      
 
Domain Number 2 Region: 487-616
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.32e-18
Family Growth factor receptor domain 0.0069
Further Details:      
 
Domain Number 3 Region: 116-201
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.23e-17
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 4 Region: 1071-1198
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.33e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 262-330
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-16
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 6 Region: 669-813
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 7 Region: 610-683
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.19e-16
Family TB module/8-cys domain 0.00061
Further Details:      
 
Domain Number 8 Region: 1647-1713
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.45e-16
Family TB module/8-cys domain 0.00073
Further Details:      
 
Domain Number 9 Region: 1159-1293
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000149
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1491-1586
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000288
Family TB module/8-cys domain 0.0000607
Further Details:      
 
Domain Number 11 Region: 405-531
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000957
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 12 Region: 1366-1488
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000022
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 13 Region: 807-888
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000589
Family TB module/8-cys domain 0.0027
Further Details:      
 
Domain Number 14 Region: 985-1114
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 15 Region: 1727-1777
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000121
Family EGF-type module 0.0025
Further Details:      
 
Domain Number 16 Region: 1564-1609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000024
Family EGF-type module 0.001
Further Details:      
 
Domain Number 17 Region: 183-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000027
Family EGF-type module 0.0022
Further Details:      
 
Domain Number 18 Region: 1326-1364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family EGF-type module 0.019
Further Details:      
 
Domain Number 19 Region: 1285-1323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000022
Family EGF-type module 0.027
Further Details:      
 
Domain Number 20 Region: 1771-1807
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000551
Family EGF-type module 0.011
Further Details:      
 
Domain Number 21 Region: 1610-1662
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family EGF-type module 0.006
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000002256
Domain Number - Region: 87-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00061
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002256   Gene: ENSXMAG00000002249   Transcript: ENSXMAT00000002261
Sequence length 1810
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556701.1:2008043:2060326:-1 gene:ENSXMAG00000002249 transcript:ENSXMAT00000002261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAYCCPGWKTLTGGNQCIVPICRSTCGDGFCSRPNMCTCPNGQIALTCGSKSVQHCNIRC
MNGGTCAEDNCQCQKGYVGNHCGQPVCENGCLNGGRCVAPNRCVCTYGFTGAQCERDYRT
GPCFASVNNQMCQGQLTGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNHRTGA
CQDVDECQAIPGICQGGNCINTVGSFECKCPAGHKFNEISQKCEDLDECSNIPGLCGVGE
CYNTVGSYFCKCPQGFYTSVDGSRCLDARGGYCYGSLVDGRCASQNSQLMTKMQCCCDSG
RCWSDGSTPEMCPIRGTEEYQRLCIQIPDSNNGVVIPGRIPGSPDLPHIYPIPIPGEVPG
QIPIQVPGHIPVHRPVVTPGQGPGPYQPQGPFPPPPGPVIIQTQNITNMCQAFRNLCLNG
RCIPLPGVGYRCECNMGFKLDTRGECIDDDECDRSPCPHGECMNTPGSYICQCPPGFQTT
ATRTECRDLDECVANGRICNNGRCVNTEGSFHCVCNAGFEISTDGKNCQDLDECLIRNMC
LNGLCINEDGSFKCICKPGFLLDTSGRMCVDIDECETPGMCMNGHCVNTEGSFRCECMAG
MAVGLDGRVCVDTHMRSSCYGGYKRGQCVQPLFGAVTKSECCCANTAYAYGEPCQPCPPE
SSAEFLALCPSGSGTTGDGRDINECALDPDICQNGICENMLRSFKCNCNVGFEVDHTGKN
CVDIDECYMNNLLCDNGLCRNTPGSFTCQCPKGYRFDTETNACEDVDECDSSPCINGDCA
NSQGSFVCSCSVGSTLDNTGLECIETETTKSTCWLKIVNDRCEVNINGATLKSHCCATLG
EAWNSPCAKCEKDPICGKGFARVRGNNCEDVDECQVFPGVCINGKCVNTQGSFFCQCPPG
MTVDISGRMCIDLRTEHCYLTHDDERCGTPISGKHRVDACCCSVGVAWGPECDECPEQGT
PEFNQLCPRGPGFSHRGDFINGRPFLKDINECRMINTLCSNGRCRNTIGSFRCRCDNGYA
LDSDERNCTDINECRISPDLCGQGRCVNTPGDFECECFEGYESGFMMMKNCMDIDECERN
PLLCRGGECVNNEGSFQCICPEGHEIAPDGSACLDINECELSDRLCRNGQCVNMIGRYQC
TCNTGYKSSEDRLDCVDIDECTIENGGCESFCTNSEGSYECSCNSGYALMPDLRTCTDID
ECEESPEVCDGGQCTNTPGTFQCLCFDGFMSSEDMKTCLDVDECELNPNICLSGNCENTK
GSFICHCDLGYSVRKGTTGCTDINECEIGAHNCDRHASCTNTAGSFKCNCAPGWIGNGLK
CTDLDECSNGTHMCSNNADCLNTMGSYRCACKEGFSGDGFHCSDSDECADNGNLCENGHC
LNLPGGFRCECDMGFITTSDGKACGDIDECSFDDICVNGRCQNIPGLFRCQCNLGYELDR
GGGNCTDINECADPAICLSGICVNIPGSYICNCPPDFQLNPTRAGCVARRKGSCYRDVRF
RGDSSESLDCSNEIGVGVSKASCCCSEGHGWGSPCELCPLGNSTEYKTLCPGGEGFRPNP
VTVILEDINECLELPGLCQGGRCINTFGSFQCECPRGFALNLETRVCEDEDINECEQPGI
CGPGQCYNTIGNYTCICPTDYMQVNGGHNCMDMRKSYCYRNFYSDNRTCDGELTFNMTKK
MCCCSYNIGRAWNRPCEQCPVPSTDEFAILCGSERPGYYIDITTGRVIDIDECREIPGVC
ENGVCINMIGSFRCECPVGFVYNDKLLICEDIDECQNGPVCQQNADCLNMPGSYRCECKA
GYRFTSTGQC
Download sequence
Identical sequences M3ZJ64
ENSXMAP00000002256 ENSXMAP00000002256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]