SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002526 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002526
Domain Number 1 Region: 11-120
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.09e-28
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002526   Gene: ENSXMAG00000002521   Transcript: ENSXMAT00000002531
Sequence length 146
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556725.1:133109:141268:1 gene:ENSXMAG00000002521 transcript:ENSXMAT00000002531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLTRGSFTYASGEEYHGEWKEGRRHGLGQLKFQDGTCYTGQFENGLFHGSGVLLFTDGS
RYEGEFAHGKFQGSGIFSRFDGMKFEGEFKDGRVEGYGLLTFPDGTHGAPRNEGLFQNHK
LQKREKCPGVVQRAQASASSAHSLAL
Download sequence
Identical sequences M3ZJY4
ENSXMAP00000002526 XP_005801611.1.87360 ENSXMAP00000002526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]