SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003320 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000003320
Domain Number 1 Region: 588-639
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000153
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 2 Region: 692-745
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000209
Family Laminin-type module 0.00018
Further Details:      
 
Domain Number 3 Region: 799-849
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 4 Region: 150-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000544
Family Laminin-type module 0.053
Further Details:      
 
Domain Number 5 Region: 309-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 6 Region: 748-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.00063
Further Details:      
 
Domain Number 7 Region: 262-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 8 Region: 206-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000273
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 9 Region: 637-694
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000314
Family Laminin-type module 0.00039
Further Details:      
 
Domain Number 10 Region: 847-892
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000113
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 11 Region: 909-920,947-1127
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000222
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000003320
Domain Number - Region: 1160-1388
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000254
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.018
Further Details:      
 
Domain Number - Region: 551-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003320   Gene: ENSXMAG00000003303   Transcript: ENSXMAT00000003325
Sequence length 1473
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557252.1:138786:157582:-1 gene:ENSXMAG00000003303 transcript:ENSXMAT00000003325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSAGKAFDITYVRLKFHTSRPESFAIYKRSREGGPWVPYQYYSGSCEKTYREPSHGFIQT
GGDEQEALCTDDFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQDWVTATDIRVTLNRL
NTFGDEVFNDPKVLKSYYYAISDFAVGGRCNDDGHASECVKDSGGRLVCDCKHNTEGVDC
SVCKAFFNDRPWMRATADSANECLPCDCNRKSSDCYFDAELYRATGHGGHCRNCADNTDG
PNCERCLDNYHRDQSGNRCLPCNCNSIGSESPQCNNRGVCACKPGVTGEKCDRCQPGFHS
LTEAGCRPCSCSPSGSTQECDVNTGQCRCKDNVEGFSCDRCKPGYFNLDPNNPQGCTACF
CFQHSSVCDSAEGYSVHTISSTFDRGTEEWSGQTRDGSTVSVQWSPAGQEVSLVSEDYQP
LYLVAPEKFLRNQMLSYGQNLSMTFRVERRDARLSAEDLILEGAGMRLAVPLIAQGNAYP
NENMQTFVFRLHEQPGYPWRPAISDSDFQKLLHNLTAIKIRGTYSERSAGYLDNVSLVTA
RRGSGVPARWVERCSCPPGYQGQHCEQCTLGYRRAQRELGPFSSCEVCNCHGHSDACHPD
TGACDCQDNTAGLSCERCKDGFYGDATQGAAGDCRPCPCPGGATCAVVPKTREVVCTNCP
AGTTGKRCELCDDGFFGDPLGQNGPARPCRSCQCSNNIDPNAVGNCNRETGECLKCIYNT
DGFFCDRCKAGFFGDPHASNPAEKCAACSCSPLGTVDQQTSCSPVTGQCQCLPNVDKRDC
SACQLGFFNLQSGNGCEECNCNPIGSTSGDCDIDSGQCECQPGVAGQHCDRCEVNFFGFS
SSGCKPCDCDHEGSLSGQCKEDGRCECRPGFVGARCDMCEENYFYNRSVPGCQQCPSCYG
LVRDKVNQQRQKLQELQTLIDNLGSGQDTVSDKAFEDRLKEAEKVIMELLAEAQNSKDAD
RGLLDRLNSLNATLTTQWNRLQSIRNTVDGTSAQADRARDRVRDAESLIDRARQELAKAK
DAVSKVDIKPTDGTGEPNNMTLLAEEARRLADKHKLDADQIEKIAKDANDTSTKAYNLLL
KTIDGESKMADDIDKLNKIYNEAKDRAKDLEKQAHKVQAEAEDAGNKALKLFANLTSLPP
FDTKTLEDDAKKIKKEASDLDNLIDKTEREYNELRDDLKPKELEVRKLLEKGKSEQQTAD
QLLARADAAKALAEEAAKKGQSTFKEAENILEDLRDFDRRVNDNKTAAEEAMKKIPVINA
TIMAANEKTRQAKEALGNAASDAGEAKRKAEEAEKIAGNIQKGSAKTKEEAEKALQDTNK
LDKDVDDMMDQLSAAEEELKKKKAEADSDMMMASMASDTAKQAEDNARKAKSTVKTVLKI
ITDLMDQLGNIDKVDLSKLNQIDESLKRAKDKMAGSELDKKLRELNDVASTQKQMIDDYD
RQIREIRSDINNLNDIKATLPEGCFNTPSLEQP
Download sequence
Identical sequences M3ZM78
ENSXMAP00000003320 ENSXMAP00000003320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]