SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004009 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004009
Domain Number 1 Region: 105-298
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.18e-57
Family Astacin 0.0000956
Further Details:      
 
Domain Number 2 Region: 726-838
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-38
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 3 Region: 414-523
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-37
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 4 Region: 571-681
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-35
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 5 Region: 305-414
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-35
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 6 Region: 862-955
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-30
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 7 Region: 679-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000184
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 8 Region: 525-568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000583
Family EGF-type module 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004009   Gene: ENSXMAG00000003972   Transcript: ENSXMAT00000004014
Sequence length 966
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557076.1:22251:39332:1 gene:ENSXMAG00000003972 transcript:ENSXMAT00000004014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSAPAVLLLLCGLSVSLATDGEAAGAIFFYPEDAVDYKDPCKAAAFLGDIALDEEDLRM
FKVSQDVDPEQHVNHTNSAGNSSSNDGAADGLSPQRQKRAASSRPERVWPNGIIPYVIGG
NFSGSQCAIFRQAMRHWEKHTCVIFTERTTEESYIIFTYRPCGCCSYVGRRGGGPQAISI
GKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVSIVRDNIQPGQDYNFLKMEPGEVDSLG
EGYDFGSIMHYARNTFSRSIFLDTILPRYDVNGVQPSIGQRTRLSEGDIAQARKLYKCAR
CGESLQDSAGNLSSPGFPNGYSAYTHCVWRISVTPGEKIVLNFTSMDLFRSHLCWYDHIE
VRDGFWRKAPLKGRFCGDTTPDPIVSNDSRLWIEFRSSSSWVGKGFSASYEAICGGELAR
DSGQIQSPNYPDDYQPNKMCVWKITVAEGFQVGLTFQSFEIEKHDACTYDYVEVRDGGSD
SSPLLGRFCGYDKPENLQSSSNQLWMKFVSDGSVNKAGFAASFLKEVDECSRPDNGHCEQ
RCMNTLGSYRCACDPGFELAADRRSCEAAACGGFITSLNGSLSTPGWPREYPHNKNCVWQ
LVAPVQYRITLTFDGFETEGNDVCKYDYVEVRSGLSADSKIHGKFCGTERPDVITSLQNN
MRIEFKSDNTVSKRGFKAHFFSDIDECSKGNGGCQHECVNTFGSYRCQCRSGFMLHDNKH
DCKEAGCDHFVNTVSGTISSPNWPNKYPSKKACTWSLSTTPGHRIKLIFNEVDMEAHLEC
AYDHLEIFDGRDVRASKLGRFCGTKTPDPVTSSSNKMFLHFFSDNSVQKRGFEASYRAEC
GGSLEAEVKTKELYSHAQFGDNNYPGGSDCLWVLTAEKGYGVEIIFQVFEIEEEADCGYD
YLELYDGADIKSPRLGRYCGSVAPEDVYSAGDAIVLKFHSDDSISKKGFHARYTSTKFQD
TLHTSI
Download sequence
Identical sequences M3ZP66
ENSXMAP00000004009 ENSXMAP00000004009 XP_005812060.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]