SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004435 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004435
Domain Number 1 Region: 471-765
Classification Level Classification E-value
Superfamily L domain-like 7.14e-46
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 2 Region: 41-393
Classification Level Classification E-value
Superfamily L domain-like 8.16e-37
Family Ngr ectodomain-like 0.0033
Further Details:      
 
Domain Number 3 Region: 858-1012
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.7e-31
Family Toll/Interleukin receptor TIR domain 0.0000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004435   Gene: ENSXMAG00000004433   Transcript: ENSXMAT00000004440
Sequence length 1026
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556696.1:1151891:1159570:-1 gene:ENSXMAG00000004433 transcript:ENSXMAT00000004440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAKCWIYLLLLGLCCHLEIQPVACKPRWTAQFLCDVTTSNSSEVQFDCSDRALEWVPSG
ITSNVTALDLSNNYLKTIKADAFSNLMNLTWLNLNLANMYKKVVFKASLRNLTRLQDLKM
SGNGLEEIPSNLPVSVEILELSSNNITNMNHTSFASLPNLTQLWLSKNCYYWNPCGKPVK
IQNNSFTHMTKLKNLDLSYNNLSNVPNGLPQSLEILNVSCNKIQYIFRDDFSGLNNLKLL
KIEGNCPRCENAPFPCVPCPNGSLGIDPYAFENLSELEEINMGGNSLEYLNPLWFKNLRK
LKHLLLSFNFLLREITGKAEFLRYLPRLEVLEFSFNYALKLYPETINLSTEFSNLQSLRT
LHMQGLVFQNIKPDTLKPLYEIRNLSALNLGTNFIIHADSTVFNKFHPLKMIYLAENRLY
PTPQKQLSNSVERYVQRSDISVSSYIKLPPKDFNFELSHGLIKQQCFNAGRVLVLSSNNL
FFISQKQFEGYGDIACLNLSSNGFSAAPNGTEFSLLPNLTYLDLSFNKIDLAYDNAFQEL
KKLEVLDLSWNDHYFQSFGVTHNLNFLKYLPVLRVLNMSHNSISTLTTKQMHSRSLEELQ
FTHNKLGTLWKVGDDSYKTLFTNLTNLTVLDISWNDIEKIPDDVYEKLPRNLIELRISNN
KMTDFSWDSLTYFHQLKILDLSYNLLSNIAGIKTVSSFSLTFLYLTHNQICHLESFFFKG
MKSLETLSLSSNKLAIINQSTFQPKPENLKTLFLQKNPFQCTCDSLDFLVWIGKRQIRIP
RLTTEVRCAMPLKDRNKPLIYFDIDQCVNDDMAFKMYVFTTFFLIFFMFVATVAHLFYWD
ASYVLHYVQAKLKGYTALSSQENIYDIFVTYDTKDPRVSEWVMMNLRVKLEEEGNKLLPL
CLEERDWPPGVPLVDNLTQSIQNSRKTLFVLTEGYVKTGVFRLAMYMAHQRLLDENEDVI
VLLMLEPVLQHSHFLRLRRRLCEKSVVEWPRTPAAEPWFWQNLRSVVKVDNQIMYSKTYK
KFFSSK
Download sequence
Identical sequences M3ZQE2
ENSXMAP00000004435 ENSXMAP00000004435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]