SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005396 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005396
Domain Number 1 Region: 786-894
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-23
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 
Domain Number 2 Region: 259-387
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.81e-18
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 164-298
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000879
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 89-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000263
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 5 Region: 7-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family EGF-type module 0.059
Further Details:      
 
Domain Number 6 Region: 667-782
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000275
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 602-705
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000298
Family Growth factor receptor domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005396   Gene: ENSXMAG00000005343   Transcript: ENSXMAT00000005402
Sequence length 972
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556876.1:811404:911653:1 gene:ENSXMAG00000005343 transcript:ENSXMAT00000005402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASADADECAEGSDDCHIDALCQNTPNSYNCICKPGYTGDGKQCEETMICEKEDNFGSSTD
CVSTNANSKCHCYPCFYLSCTGSSVSVCVCPDVDECLDNNGGCQQVCVNTMGSYECQCKD
GFFLSDNQHTCIHRSDDGMNCMNKDHGCAHICREAPFKSGVSCECRPGFELAKNQKDCTL
TCNYGNGGCQHTCEDTDTGPVCGCHQKYALHSDSKTCIESCAVNNGGCDRTCKDTATGVR
CSCPVGFTLQPDGKTCKDIDECEENNGGCDHFCRNTVGSFECSCQKGYKLLTDERTCKDI
DECSFERTCDHTCINYPGSFECLCNKGYILYGLTHCGVDVDECSINNGSCEYGCLNTQGS
YECVCPPGQKLHWNKKDCIEAVKCLPNGKPAPRAQLVCTKSGDAEVCSLSCPSNALFLAD
SENYTLSCGVPIQPAADMGCGACGFSPCKNHCTKNPLAPPIKQKAKFKIKDAKCHLSPRS
KEKHKDSSRQNIQGGQFPCTDDCQVTFVNLKCDSSKKRRRGRKSPSKEVSLITAEFEMEM
KEEEASDSCNIDCVRDKMRQKLQIAMRTLRKSINKQQFYIQFSGTEYEVAQKPSRIPEGA
DTCSTGQVFQDGKCVSCGAGTFYSGEQEQCVQCPPGTYQDMEGQLSCEPCPSTEGQGIAG
AKNVSQCGGQCPAGQFSTDGFRPCQLCPLGSYQPEPGRVLCFPCGGGLMTKYEASVTFRD
CEAKVHCAPGHYYNSSTHRCIRCPAGTYQSEFGQNYCINCPGNTTTDFDGATNVSHCKNQ
MCGGELGDYTGYIESPNYPGDYPSNVDCVWTIIPPHKRRILIVVPEIFLPIEDECGDVLV
MRKSAVPTSITTYETCQTYERPIAFTSRSRRLWIQFKSNEGNSGKGFQVPYVTYDEDYQQ
LIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTSAESKEMFPRSFIKLL
RSKVTRFLRPYS
Download sequence
Identical sequences M3ZT53
ENSXMAP00000005396 ENSXMAP00000005396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]