SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006322 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006322
Domain Number 1 Region: 434-671
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.76e-79
Family Eukaryotic proteases 0.00000174
Further Details:      
 
Domain Number 2 Region: 39-100
Classification Level Classification E-value
Superfamily GLA-domain 2.02e-23
Family GLA-domain 0.00035
Further Details:      
 
Domain Number 3 Region: 85-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000026
Family EGF-type module 0.009
Further Details:      
 
Domain Number 4 Region: 125-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000785
Family EGF-type module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006322   Gene: ENSXMAG00000006266   Transcript: ENSXMAT00000006330
Sequence length 693
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557086.1:314607:323113:-1 gene:ENSXMAG00000006266 transcript:ENSXMAT00000006330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TYAFRNTPEWLVLRMDAPSAVFVEKHEAASVLRRWRRANSGFLEELKQGNLERECIEEIC
DYEEAREVFEDDQQTRDFWKTYEKRDPCLVNPCFNNGTCIYMGASYECQCPEGYEGRYCQ
TDSLGCLYQNGHCEHFCNSSGARRKCFCADGYQLADNGKKCVPKVAFPCGRVASPATGPN
QTMQDQAAAMFRSFLNQSPLRWSSGPTGLGHHRGPLRSWEEPPAARCGGRKPNSTSPTTC
CAPGTWMETRTEIHSGTKTLKLETFWLKDSKIMNEQSEQTDSRVQGNLKKATWRGSATRN
AAAGRKHERSLKIKRELRDTRASTVKSVKQKSLSKRRSVSVSFQLSRSSVKMKTEAVIIS
AALPTETLSARVLMDTSWVKMESPVNPMVRKTHVMIQVEHRRSGRVIKQHTPASTFRFNN
GMQSFTSNEHDDLSGTIRIVDGEDCPAGECPWQALLINEDNIGFCGGTILTEYIILTAAH
CMNQSRYFVVKVGEHNTTQQTSWEMSHEVDAIVSHFKYNPETYNNDIALVKLSKPIRFNK
YILPACIPQPDFAENVLMRQRDGLVSGFGRLGEGREASTILQRLSVPYVDRLTCIESTQL
RISMRMFCAGYDTIAKDACQGDSGGPHVTRYHDTYFITGIVSWGEGCARKGKYGVYTQVS
KYIHWIREGIKKLTPRVENRQRRDHGAIKRLFL
Download sequence
Identical sequences M3ZVS8
ENSXMAP00000006322 ENSXMAP00000006322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]