SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000007264 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000007264
Domain Number 1 Region: 336-469,793-967
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.07e-52
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 68-191
Classification Level Classification E-value
Superfamily PH domain-like 2.62e-29
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 1173-1237
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2e-17
Family SAM (sterile alpha motif) domain 0.0028
Further Details:      
 
Domain Number 4 Region: 237-305
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000194
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000533
Further Details:      
 
Domain Number 5 Region: 177-233
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000553
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000007264   Gene: ENSXMAG00000007213   Transcript: ENSXMAT00000007272
Sequence length 1242
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556763.1:858509:919785:1 gene:ENSXMAG00000007213 transcript:ENSXMAT00000007272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSGRGGLHQPQSEPEKGAVSSAAGVHAHVVGAVAGSGAADESSDSEAEQEGPQKLIRKVS
TSGQIRSKTSIKEGLLLKQTSSFQRWKKRYFKLRGRTLYYAKDAKSLIFDEVDLSDASVA
ESSTKNVNNSFTVITPFRRLILCAENRKEMEDWISSLKSVQSREHYETAQFNVEHFSGMH
NWYACSHARPTFCNVCKDSLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKD
IIEDEDGIAMPHQWLEGNLPVSAKCACDKTCGSVLRLQDWRCLWCKAMVHTACMDLYPRK
CPLGQCKVSIIPPTALNSIDSDGFWKATCPPSCASPLLVFVNSKSGDNQGVKFLRRFKQL
LNPAQVFDLVNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLHKQCQLGVLP
LGTGNDLARVLGWGPSCDDDTQLPQILEKLERASTKMLDRWSIMTYEIKIPPKHSCPTTP
EGADDCQFHISAYEHSVTTHLTKILSSDQHSVVISSAKILCETVKDFIAKVGKAYEKSTE
NVEECDSMSLKCAILNEKLDSLLQTLNAECQSLPQLPHCTPPIVEEEQEEEEEEEEEEEE
EASEESLTELKGKLEEEETEKGRGGSGPPQQLFKSREQLMLRANSLKKAVRQIIDQAVRV
VDEQNAHTDDTELPSPLEFRKDSEDENRDSEKDEDTKELEAVSSARSPCSPTESRVSRST
QSYGPFTITPFTASKENLPVLNTRIICPGLRAGLAASIAGSSIISKMLLANIDPFGATPF
IDPDLDSLEGYMEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNMMWYGVLGTK
ELLQRTYKNLEQKVQLECDGQYIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDIFCAPSF
DDKILEVVAVFGSMQMAVSRVIKLQHHRIAQCRTVKITILGDEGVPIQVDGEAWIQPPGV
IKIQHKNRAQMLTRDRAFENTLKSWEDKLKYDKPPLRPHLYPQQSVDLATEEENALMQMC
ARAAEELITRICEAAKTNGLLEQELAHAVNAASHAINKMHPKFPESLTRNTAIEVASTVK
ALHNETESLLLGRVSLQLDPPEEEQLSSALQSLDAELGKLGEIPWLYHILQPNDEEDPSL
GYGKRNSRSSVFRIVPKFKKEKAAKKTSPQSVVERWGTEEVGVWLEQLSLGEYRDTFIRH
DIRGSELLHLERRDLKDLGISKVGHMKRILQGTKELAKVSMV
Download sequence
Identical sequences M3ZYH0
ENSXMAP00000007264 ENSXMAP00000007264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]