SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000007838 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000007838
Domain Number 1 Region: 279-502
Classification Level Classification E-value
Superfamily SIS domain 9.14e-19
Family mono-SIS domain 0.0014
Further Details:      
 
Domain Number 2 Region: 11-160
Classification Level Classification E-value
Superfamily SIS domain 0.000000105
Family mono-SIS domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000007838   Gene: ENSXMAG00000007815   Transcript: ENSXMAT00000007846
Sequence length 579
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556962.1:106228:111592:-1 gene:ENSXMAG00000007815 transcript:ENSXMAT00000007846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQSADYEPTLPVTEKSNPLTRDIDRASASSIVKMLQACDAQMFQEKSQTEYQRLLSEEIV
KTLMEVAERVRLILKDPQDSLVVLSGCGTSGRLAFFMASGFNRELQRLNYAPICSYVIAG
GDRALFSSQEAPEDDPTLGALRLKKVSEGKKRVLFIGVSCGLSAPFVAGQLDFCLRHPDV
YTPVLVGFNPAHQARNEPLPGCTLTFRSVVTRMEELAKTQKAFLINPALGPEAISGSSRM
KGGSATKILLEVVFSASFSRTPVTFNGILQHMRSYKKALDFTYSHSEEIAVLTEAAGRSL
QCGRQVCYLGWGSLGLLGLIDASECKPTFGADYEDIRGFVSGGYKELGNNEGDLTLMGPE
FSISHDDFLDRVLPRLTDDDTVLLLYSDSDDVDEVAKLAHRVREKTPNIHAAYHQTDGGT
AAQQDDINKLCSSTINFTWSQETPKRLQHMQRELSTKLLLNAVSTGAHILKGKVFKNYMV
DLQVTNSKLYRRAARLLQELSSHSESQSEEALLKAIYQVDKLSEDIMTCSLDTHTHTAGK
AKKVVPLALVCLLTGCSIKEAETRLEHQPIVREAVEACL
Download sequence
Identical sequences M4A044
ENSXMAP00000007838 ENSXMAP00000007838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]