SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000008759 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000008759
Domain Number 1 Region: 52-206
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-44
Family C-type lectin domain 0.00000295
Further Details:      
 
Domain Number 2 Region: 207-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000125
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 3 Region: 3-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000365
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000008759   Gene: ENSXMAG00000008743   Transcript: ENSXMAT00000008773
Sequence length 309
Comment pep:novel scaffold:Xipmac4.4.2:JH557505.1:61885:70198:-1 gene:ENSXMAG00000008743 transcript:ENSXMAT00000008773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGMYSCKENICLNGGSCFKSGSIYSCSCSPGYTGHQCETDIDECQSNPCRNGGTCVDGLA
SFTCVCLPSYSGLYCEKDTEICDYGWHKFQGHCYKFFPQRKGWDSAERECRIQGAHLTSI
LSHEEQQFVNRLGQDYQWVGLNDKMFDNDFRWTDGSPVQYENWRPNQPDSFFSSGEDCVV
MIWHEGGQWNDVPCNYHLTFTCKKGTVACSQPPVVENARTFGRKRERYEINTLVRYQCRN
GFIQRHVPTIRCRGDGRWDTPKITCISPSSYQRSFMRRHQPHALYSINNFKKWQDQTLRH
HHQRNRGRR
Download sequence
Identical sequences M4A2R5
ENSXMAP00000008759 ENSXMAP00000008759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]