SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009536 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009536
Domain Number 1 Region: 831-944
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-25
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 2 Region: 307-427
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-17
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 31-160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.34e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 269-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000875
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 650-812
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000999
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 6 Region: 159-307
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000832
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009536   Gene: ENSXMAG00000009507   Transcript: ENSXMAT00000009550
Sequence length 1020
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557085.1:270406:292058:1 gene:ENSXMAG00000009507 transcript:ENSXMAT00000009550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAICAARNFCLFLLLLNSRQSIALPETRDPCAEGSDGCHIDAICQTIQGSYKCTCKGGF
KGDGKHCEDIDECDLEYNGGCVHECTNIPGNYRCTCYDGFNLANDGHNCLDVDECMFNNG
GCQHTCVNTVGSYECRCKEGFFLSDNQHTCIHRSIEGLNCMNKEHGCAHICKESHRGGVA
CECRPGFELARNQRDCILTCNHGNGGCQHTCEDTEDGPFCRCHVRYTLQPDKKTCVERDE
ATTESSDHNATSSTEADKRVKRRLSMETCALNNGGCDSTCKDTSTGVRCSCPDGFTLQLD
GKSCKDIDECESHNGSCEHFCKNTVGSFECNCRKGFKLLSDERSCQDIDECYFERTCDHT
CVNSPGGFQCLCNKGYTLYGLAHCGDVNECSVNNGGCEHECENTVGGFECFCRPGYKLHW
NKKDCVKAEGLTPANPPSKPTLNCSKQHGGDRCFLNCQSQVHISSGTEDSYTVTCGMPLP
CLAGIQKSNSGSHCLGPAKAGVHRIKTTATFKSGTAKCNLKRSQEKLWESFSSAHSDCSF
LFTENVQFSYVRLHCTSLGQRTRSRHSRKAVEDDGFAITAEFELDVNLEEVTAESCDLNC
VRRRSEKRLRKTIRTLRKSINREQFHLHFAGADYDLSRSQRQLVELPGHCLAGQVLVGRK
CVSCSAGTYYDGDQGHCVPCPAGTYQDEEGQMSCEICPTPDGREVTKVIGARNMSECGGQ
CPPGQYSHDGFVPCLPCPLGTYQPEVGRTTCFLCGGNLVTKYSAAVSFQECETKVQCSPG
HYYNTSTHRCIRCPTGTYQGEFGQNYCVTCPGNTSTDFDGSTNIMQCKNRQCGGELGEFS
GYIESPNYPGNYPSNIECTWTINPPPKRRVLIVVPEIYLPIEDECGDYLVMRKSSLPNSV
TTYETCQTYERPIAFTSRSKRLWIQFRSNEGNSAKGFQVLYVTYDEDYQELIEDIVRDGR
LYASVNHQEILKDKKLMKALFDVLAHPQNYFNYTTQESKEMFPKSFIRFVRSKVMRFFRP
Download sequence
Identical sequences M4A4Z2
ENSXMAP00000009536 ENSXMAP00000009536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]