SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009618 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009618
Domain Number 1 Region: 215-360
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-25
Family Third domain of FERM 0.0035
Further Details:      
 
Domain Number 2 Region: 103-214
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-22
Family Second domain of FERM 0.0074
Further Details:      
 
Domain Number 3 Region: 9-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.96e-17
Family First domain of FERM 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009618   Gene: ENSXMAG00000009593   Transcript: ENSXMAT00000009632
Sequence length 547
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556858.1:882948:891127:1 gene:ENSXMAG00000009593 transcript:ENSXMAT00000009632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPTKHERTVCVLLPNKSQLDVTIGLKSTGQDVFNSIAELLGIKEMHFFGLTVVRDNEH
IFLDMEEKLAKYFSKEWRQDSGKGTLKRQIPLLLFLKVQFYVENGRLFCERKARHFYYSD
LRERVRRSECRQQEEVYFQLAGYALQADLGDCPMQREGMEVTSYFEPKDYFPPWIIAKRG
VKYLLCHGPKVHQELWGMSTRDAIFSFIRDSCQLEDVPVTFYRLQKDKKEEKGTALLGLT
LRGMQVYQEVNNIRQLLYDFPWSNVGRLTFLGKKFEIQPDGLPSARKLVYYTGSSFRSRH
LLLHLSNSHQVYLSLQPALKHLRQVEESKEKKRYRESYISDDLDMDPPGSESSPGLSRRS
TGSSGIEADARQHSISTEMTSMGEEVLQHREKCLSSATSQDSSSMSESDRCEMSQLADLL
DGVSVDFARCPAETQSPGISLNHVDSTVYKRQPQHADQDTLLPIQKMKFYNPTHFIRHSL
HDVHLCPPSAPTGMALPSVSYHNYTSGLPDYYPYLHCQAKPSFYGHRSTNCLALDTLSDE
QFLEFIL
Download sequence
Identical sequences M4A574
ENSXMAP00000009618 ENSXMAP00000009618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]