SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000010372 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000010372
Domain Number 1 Region: 146-326
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.7e-47
Family CRAL/TRIO domain 0.000000471
Further Details:      
 
Domain Number 2 Region: 67-141
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000000000772
Family CRAL/TRIO N-terminal domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000010372   Gene: ENSXMAG00000010350   Transcript: ENSXMAT00000010386
Sequence length 356
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557278.1:20181:30649:1 gene:ENSXMAG00000010350 transcript:ENSXMAT00000010386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTFKVLTEVTKQPTFTPLYSKLQVHSDSQSLPSGSRTGPSCPVASSVRRRPAAESRPEC
DMNGSQITELPDDSEQLRPHVVSLRRAALQAYDLPAVGTFSDGFLIRFLRARDFDLTLSL
KLLLNYLHWRRESPEISTCLSPSSVFGLLKTSYHAVLPQRDHAGSRVLIYRIGQWNPKDW
SAFQVFRVSLMTSEIISRETETQRRGLKVIFDLKGWSLGHALQINPSLARKISSVLSDSF
PLKVRGIHLVNEPIFFRPVFTMIRPFLPDKIKQRVHMHGTDFHRTLSDLFSPDVLPPEYG
GEGLGIEEVCQAWTQELFQSENLLKQIASHPTGDLSTNTGDTLISEENETMTLTEG
Download sequence
Identical sequences M4A7C8
ENSXMAP00000010372 ENSXMAP00000010372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]