SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000010530 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000010530
Domain Number 1 Region: 838-915
Classification Level Classification E-value
Superfamily DEATH domain 4.04e-18
Family DEATH domain, DD 0.0000659
Further Details:      
 
Domain Number 2 Region: 243-294
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000157
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 3 Region: 153-244
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000159
Family I set domains 0.04
Further Details:      
 
Domain Number 4 Region: 297-351
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000301
Family TSP-1 type 1 repeat 0.00059
Further Details:      
 
Domain Number 5 Region: 46-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000089
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000010530   Gene: ENSXMAG00000010494   Transcript: ENSXMAT00000010544
Sequence length 961
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556829.1:610557:841082:-1 gene:ENSXMAG00000010494 transcript:ENSXMAT00000010544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDARTKGRFLFAVGLLCGFYWPASVTSKGAPAGQADTLPSAQGTLPHFIQEPEDAYIVKS
NPIKLRCRATPALQIFFKCNGEWVHQNEHTSQEYKALNTGLKVREVMINVSRQQVEDFHG
PEDYWCLCVAWSHLGTSKSRKATVRIAYLRKNFEQDPQGKEVPINGMIVLHCRPPEGVPA
AEVEWQKNDELVSSLTDDQLDTRADYSLIINEARLSDSGNYTCLASNVVAKRRSATAPVI
VYVNGGWSLWTEWSACNVPCGRGIQKRSRTCTNPAPLNGGAFCEGMSVQKITCNALCPVD
GGWDEWSEWTACSSQCERQRSRECNSPAPRHRGKTCEGSGKATENCTDGLCTQNRKLLHD
VKPQNMESSIDVALYSGLGAGIVAVVILVVAVMLYRKSHSDYGVDVIDSSALTGGFQSFN
FKTTRQGNPLLLNSSMPPDMTVGRTYSTPLCFHDGADKELFDPLPDIKVKVQSSFMVSLG
VAERAEFHAKAPGESYPQDLSCDFCSTVDKRKKGPLMLNGPLSGSREQLRTSGVFGHVGG
RLVVPNTGVSLLVPHGAVAENMSWEMCMVINQGEASAQTLEGCEILLGPEVTYGPSGLDL
FCPVAMTVAHCAEVDAENWNIQLKRKTQDGKWEEVMSVEEESASCYCLMDSSSCHLLLDQ
PGSYALVGEPLTQAAVKRLKLAVFGSVEAGALNYSLRVYCVDDTPHAFQGVVAAETSRGG
QLLEEPKTLPFRANTFSLQVSIQDVPQFLWRIKPFTTCQEFSFPQVWCSNQQPLHCAFQL
ERYSPAAAQLSCKISVRQVKGHEQILQVYTAVAEGEKEPVPFFMQTDCTVTSQTGPKAFK
IPLSIRQRICATFDTANAKGKDWQLLAQKLHLDRNLGYFAKQRSPSAVILSLWEARHQDS
ADLDSLASALEEIGKIHSKSSPKDPEEAEPDLNHIEAGGLYGTANPAAVPAGEDCAPEYT
G
Download sequence
Identical sequences M4A7T6
ENSXMAP00000010530 ENSXMAP00000010530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]