SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000010909 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000010909
Domain Number 1 Region: 213-241,268-468
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-55
Family Voltage-gated potassium channels 0.0007
Further Details:      
 
Domain Number 2 Region: 87-184
Classification Level Classification E-value
Superfamily POZ domain 1.6e-25
Family Tetramerization domain of potassium channels 0.00000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000010909   Gene: ENSXMAG00000010891   Transcript: ENSXMAT00000010923
Sequence length 519
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557509.1:3989:5680:-1 gene:ENSXMAG00000010891 transcript:ENSXMAT00000010923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LASKQAMEVPLVNFENMDDVGINEGLSPSTPPTLTSKANSSSGSLISSLKLLANSESPTD
SVFSKMLKDYYENEDLFEKHCLEEKDEKVVINISGLMFETQLSTLSKFPETLLGDPMKRL
QYFDPMKNEYFFDRNRPSFDGILYYYQSGGRLRRPANVPLDIFANEIVFYELGHEAMEQF
REDEGFIKEPEVLLPTNELKKQFWLLFEYPESSSAARSVALVSVFVIVISIFIFCLETLP
EFRDDSDFPPGFIQMINGTASYPAPKTVWTYLTDPFFIVETICIIWFCFELGVRFVVCPS
KSDFFNNIMNIIDIVSIIPYFVTLGTELATKPDEDLNAGQNMSLAILRIIRLVRVFRIFK
LSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAIYFAEVDEPQTQFVSIPDGFW
WAVVSMTTVGYGDMCPITMGGKMVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEK
QVMDAAAEAAQKMSAANKYGSTLSLNKSNGTFQNEKNGM
Download sequence
Identical sequences M4A8W5
ENSXMAP00000010909 ENSXMAP00000010909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]