SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000011622 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000011622
Domain Number 1 Region: 489-600
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-25
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 2 Region: 305-423
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-16
Family Spermadhesin, CUB domain 0.0039
Further Details:      
 
Domain Number 3 Region: 605-676
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000737
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 734-793
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000183
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 666-727
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000347
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 6 Region: 248-312
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000751
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 132-249
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000811
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Domain Number 8 Region: 428-493
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000292
Family Complement control module/SCR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000011622   Gene: ENSXMAG00000011571   Transcript: ENSXMAT00000011636
Sequence length 891
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556840.1:71864:89087:1 gene:ENSXMAG00000011571 transcript:ENSXMAT00000011636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFAHLAVMFSVTMMHVVSGMTFMTPESDTSPTSAPDSYPPGELIHAALQSKEYLGQVSG
GSGTTTNPTQAVPGLGMAESTATAISPGLLTTALGSSSAAGKTGSRSPMSSFPLEEETTT
TLITTTTITTMHMPVQCNATLSAMEDFVESPDPGSSSSFSTLECTYSITVYPGYGVEIQV
RKTNLSKEESLVIMGHGGAGPELLANETLMKEGQVIRSTTNQVSIHYRSLRQSNHGTFSL
HYQAFLLSCPFPTSPEGGGVTVTDIHPGGQAHFHCDPGFQIRGHEVATCVNTTQPHWSTH
EPQCVVVSCGGWIRNATVGRILSPPPPPASNHSNGNNLSCHWLIEAKEGHRLHLHFERIA
LDEDDDRLLVRSGNSSLSHLLFDSDLDDVPERGLLSEGSTLYLELTADSSSIPLLLALRY
EAFDDEHCWEPYMPHGNFSSSDISYQLGTIVTFSCSPGFVMEQGSGTIECVDPSNPHWND
TEPVCRALCGGELTEPSGTILSPDWPQSYSKGLDCIWQIHGNEEKRIELEVKILNIRHTD
VLTVFDGHDVMSHVIGQYMGSKERFQIVSGGSEVTIQFQSDPDDSSFILSQGFLIHYREV
EPNDTCPTLPQIEFGWISSSHSSPVRGSVLTYQCQPGYDISGSDIITCQWDLSWSSTPPT
CVKVQQCPDPGEVVNGARSVRPEAGFALGTVVRFSCNQGYQLEGPSQISCYGRDTGTPKW
SDRSPKCVLKYDPCPNPGVPDNGYQTLYKHSYQAGETLRFFCYEGYELIGEVIITCVPGH
PSQWNSPPPFCKVAYEELLDDHKSEVSQSFEPSRQILSENIALAIILPIILVILLIGGIY
MYYTNICRLEWKPLFWKSLSHTHSYSPITVESDFNNPLYEAGDTREYEVSI
Download sequence
Identical sequences M4AAX8
XP_005807043.1.87360 ENSXMAP00000011622 ENSXMAP00000011622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]