SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012455 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012455
Domain Number 1 Region: 91-156
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000624
Family Ovomucoid domain III-like 0.00077
Further Details:      
 
Domain Number 2 Region: 181-231
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000013
Family Ovomucoid domain III-like 0.0049
Further Details:      
 
Domain Number 3 Region: 23-66
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000445
Family TB module/8-cys domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012455   Gene: ENSXMAG00000012436   Transcript: ENSXMAT00000012471
Sequence length 248
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556665.1:2727670:2733105:1 gene:ENSXMAG00000012436 transcript:ENSXMAT00000012471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCLIFALVVILSLCQIGRNPVDAGMCWLQHGPDHRCDMVLMREVSREECCDGGRLDTAW
SNTSLPLNEVSLLGFLGIVSCKPCRDSCEGVKCSPGKVCKMKMGRPQCVCSPDCSHIPRK
HAVCGSDGKSYRDECALLMARCMGQPDLEVMYQGECKKSCSNVVCPGTHTCVTDQTNSAH
CVMCRTSPCPVTSEQQICGNDNITYQSACHLRRATCFLGHSIGVRHYGHCNSPPRNSHKF
RASEENAV
Download sequence
Identical sequences M4ADB1
ENSXMAP00000012455 ENSXMAP00000012455 XP_005795767.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]