SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000013088 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000013088
Domain Number 1 Region: 137-299
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.27e-47
Family CRAL/TRIO domain 0.0000531
Further Details:      
 
Domain Number 2 Region: 40-132
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000000000000144
Family CRAL/TRIO N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000013088   Gene: ENSXMAG00000013063   Transcript: ENSXMAT00000013104
Sequence length 307
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556851.1:957725:965021:-1 gene:ENSXMAG00000013063 transcript:ENSXMAT00000013104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVSGTYRMVSEEEQALRAKLEHLTIKDHGPVFGPCASLPDHTRQKAKDELNETDEKRV
SAAKELRGIIKEKAEAGDDLAKGVQDTFGEKPDSLLVRFIRARKYDVPRAFDLMKGYVRF
RKDYPELFENLTPEAVRSTIEAGYPGILHSRDKYGRVVLLFNIENWDYEEITFDEILRAY
CVILEKLLENEETQINGFCIIENFKGFTMQQASGIKPTELKKMVDMLQDSFPARFKAVHF
IHQPWYFTTTYNVVKPLMKSKLLERVFVHGDELENYYKEFDPEILPSEFDGKGSKYDGKA
TASKLFD
Download sequence
Identical sequences M4AF44
ENSXMAP00000013088 ENSXMAP00000013088 XP_005807505.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]