SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000013198 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000013198
Domain Number 1 Region: 101-235
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.51e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 2 Region: 231-285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000782
Family EGF-type module 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000013198
Domain Number - Region: 272-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00074
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 47-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00088
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000013198   Gene: ENSXMAG00000013161   Transcript: ENSXMAT00000013214
Sequence length 434
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556698.1:288899:302883:1 gene:ENSXMAG00000013161 transcript:ENSXMAT00000013214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGICASVLCVCICVSALLRSAISQSHIKTYTNTECTDGYHWDPLTEHCKDINECETIPD
ACKGEMKCFNHYGGYLCLPRSASVIPAPEPSITPTPAFNPCPPGYEPHGDSCVDIDECER
DEHDCQPSQQCTNTLGAFNCQCPRGYSKVGTECIDIDECRFRYCQHRCVNVPGSFSCQCE
PGFQVGGNNRSCVDVNECEMGAPCSQRCFNTYGTFMCRCDQGYELGPDGFTCNDIDECRS
SSYHCQFRCVNEPGKFSCVCPEGYQLVGTRMCQDINECETGEHQCSDTQTCVNIHGRYQC
VDANRCQEPYVHNSDNVCVCPNNKPACKDLPYSVVHRYMTITSERSAPSDIFLIQTTSFL
TGSFNTFRIRSGDDNRDFYIRQTNNYSAMLVLARAVSGPREYTLDLEMLSIHPVLSHRSR
SVLRLSVFVGPYTF
Download sequence
Identical sequences M4AFF4
ENSXMAP00000013198 ENSXMAP00000013198 XP_005799545.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]