SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000013253 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000013253
Domain Number 1 Region: 9-170
Classification Level Classification E-value
Superfamily RUN domain-like 2.35e-40
Family RUN domain 0.00059
Further Details:      
 
Domain Number 2 Region: 1394-1508
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 5.49e-26
Family Supernatant protein factor (SPF), C-terminal domain 0.0022
Further Details:      
 
Domain Number 3 Region: 1195-1262
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.53e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0017
Further Details:      
 
Domain Number 4 Region: 432-623
Classification Level Classification E-value
Superfamily Tropomyosin 0.000049
Family Tropomyosin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000013253   Gene: ENSXMAG00000013225   Transcript: ENSXMAT00000013269
Sequence length 1510
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556665.1:5022300:5041652:-1 gene:ENSXMAG00000013225 transcript:ENSXMAT00000013269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGESQLQRIIRDLHDAVAELAKEYKESGEPITDDSVNLHKFSYKLEYLLQFDQKEKTT
FLGTKKDYWDYFSDCLAKIKGANDGIRFVKSISELRTSLGKGRAFIRYSLVHQRLADTLQ
QCLMNQRVTSDWYYARSPFLKPHLSSDIINHLYELNEVQFDVASRGHDLDASWPTFARRT
VGSANSPGHMWKAPSRSSSINSLASSYSQQAPECASSPDYGQSLLNDLNDSLPACMEDNN
TVENLRLELDQSELRQRDLLDKVQQLGEESGELKGVIEELQRQLDVSLAAQEGHQGLQEE
LRALQGRDVALTRQVEALRAEEKAKETQLVLLQEKLAAAEQKNMELMAKLDGFLDEKGQQ
AASHFDSALKIHELLDKLKEAEKVKMEAEAKMVENRRQVERLEEEVQVNEMKSKENERKL
EALVTSLSEEKAKLNAKVEEQFSTLEKLQGDLALREKDANNLQRQLQNIQQSLKEKEQEL
EEVKKGAKQEIEEMQKNVDDLKESLEGKVAEITVQLTNREAELISSSETLQKLEAKNQIL
TTERDELTTSLNQHKTKINKQAAKIEDYQTQCASLQELKEKLQATVSRNEEQQNEMTEDR
AALQAELAALRASEKQLRGQVDNAKMTVDEKEKVLREENRSLDESLQRVTMAAKQSEMTS
KRLEQENQTLREELDDLKATLSRIETNLKNGRIQIEEHKKNLEASNTKLVSLQEQLSAKE
EQLENKEKEVVKLMSTLQELEAKEKENEMAKANAETTCAKQAELIERITSEKQAIETLQL
ERSSVQAKENQEVTVKLTVVEGQLEVSMKEVSRLQAKILDLKVQVQRSEEEKLKSHAQLE
VTVAQRDELRCLTEQLKSQAEELNQKHIAELLECKKKEEALAQQRDREAAAHAELAISSS
AVREELAALKAENNKLALENTEIREGLHRANTEMAELGMSICKLNAEREEASEHLAGDAA
KIEELEKEVERIEECMNDLRQENNSLREELTQKESLPRAITELQEELEKAKNQVHSIKEC
CQEEMDAVKFQMSSETMSHQAQIKAVTENLEKISAQLEEEQKNVSSLEAEVSELKAANEK
YLQLIGEKDAYITQAEATIRDNEGKIQQLSSSTASIEEAHLSMQTLCEELKQKFKATEAE
KQSQYLTMSAEIEDLNSTKINLEERLIELIKDKDALWQKSDALEFEQKLRAEERWWLVDK
EATHCLDCNDQFTWWVRRHHCRVCGRIFCYNCSNNFVLTKHSGKKERCCRDCYMQHNAVV
EKFVESEMSSSDVLPSPARAGPQPPPEPAPYKSPSSATVSDTGIKSDDGGYDIITEEEVN
GVYDSDSNSQTTGGSLEGEQDRQQPGAREIGPGEVAPDDDSVPTVQDSEINLLRSGDVTL
TVPLSVEDISQFGDGSRELFIKSSCYSTINITVTDCETTIGWMFSSEPRSISLGVVYRES
SDSDVEQAKVLIPLTRCNSHKEKIQGQVKARHPGLYTLIFDNSFSRFISKKVFYHLTMEK
PVIYDGSDGP
Download sequence
Identical sequences M4AFK9
ENSXMAP00000013253 ENSXMAP00000013253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]