SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014915 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014915
Domain Number 1 Region: 291-404
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000424
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 2 Region: 159-293
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000008
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number 3 Region: 212-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family EGF-type module 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014915   Gene: ENSXMAG00000014878   Transcript: ENSXMAT00000014935
Sequence length 637
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556772.1:1221283:1226557:1 gene:ENSXMAG00000014878 transcript:ENSXMAT00000014935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTFSLIIEALHTDSLDDLTTDNPERLISRFTTQRHLTVGEEWSKDMQTASRTELRFSYRF
LCDEHYYGDGCSVFCRPRDDAFGHFTCGERGEIICNSGWKGQYCTEPICLPGCDEEHGFC
DKPGECKCRVGFSGRYCDDCIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKP
CLNGATCTNTGQGSYTCSCPPGHTGANCEIQVNECSGNPCRNGGSCIDNDNGYKCTCPPG
FYGNNCELSANTCADGPCFNGGRCVDNPEGGYFCQCLMGYAGFTCEKKIDHCSSNPCLSG
AECVDLVNSYLCECPEGFSGPNCEVSSGISALCQSFPCQNGGTCQDTVDGYTCNCPPGYT
GKNCSSPISRCIHNPCHNGATCHERGGRYVCACVPGYGGNNCQFLLPEVPKGSQPVVDGP
DRRYSSSESGNTDTEEDDDSGFPWTAVCAGVFLVLVILISCSVLVVYVRVKLQTRHSHHS
ESVHSDSQETMNNLTTNNCLRSDKEHGGMMTTSIKNTNKKADYHSDLAGSIGGLSGISSL
NGSEKNGFKPRYPSVEYNLVHELRQEDLSPCTEEECKQTEPKCEPLDEPSRGEGFRKRQN
SDVSENDSRYPCSSDTKYQSVYVISDQKDECIIATEV
Download sequence
Identical sequences M4AKC1
ENSXMAP00000014915 ENSXMAP00000014915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]