SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014968 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014968
Domain Number 1 Region: 566-637
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.49e-17
Family TB module/8-cys domain 0.0007
Further Details:      
 
Domain Number 2 Region: 1017-1137
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.15e-16
Family Growth factor receptor domain 0.0035
Further Details:      
 
Domain Number 3 Region: 1404-1469
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.79e-16
Family TB module/8-cys domain 0.002
Further Details:      
 
Domain Number 4 Region: 1238-1299
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000222
Family TB module/8-cys domain 0.00032
Further Details:      
 
Domain Number 5 Region: 452-515
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000301
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 6 Region: 513-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000578
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 7 Region: 965-1013
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000254
Family EGF-type module 0.008
Further Details:      
 
Domain Number 8 Region: 1555-1604
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000967
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 9 Region: 926-964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 10 Region: 776-826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000447
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 815-851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000503
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 12 Region: 1526-1567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000795
Family EGF-type module 0.019
Further Details:      
 
Domain Number 13 Region: 1310-1362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000963
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 14 Region: 1349-1392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000113
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 15 Region: 297-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000138
Family EGF-type module 0.038
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000014968
Domain Number - Region: 890-939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000108
Family EGF-type module 0.007
Further Details:      
 
Domain Number - Region: 1127-1173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000144
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014968   Gene: ENSXMAG00000014900   Transcript: ENSXMAT00000014988
Sequence length 1604
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556879.1:754532:790818:1 gene:ENSXMAG00000014900 transcript:ENSXMAT00000014988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRSAASQPPQPEDGGVRPGEQLQTDPGGVRTWFRSQSTGAPAGGARRRAALSGPRVCGG
RCCLGWTVSPKTRRCTKPRCFPSCRNGSSCGLPNNCLCGKGFYGVRCQFSKVPLPVGRPP
ETSSHPASTTTAAGPIGSSRKPEPPVVLIIALLSTFILEPLFEFGLAAQLLCNDVSVSCF
EMIINFPSTRQFPFYKKTFPGPTSGVSAEQLRLACFPLLFIFLASPGPTRGQTGARRGLE
RIQVRFTPTICKVLCNQDGCINRCEQGNVTTLYSADGRATGRRDGAHGPGFRVFLCPLLC
KNGGVCLQMDRCLCPANFTGKFCQIPVPPPGAASTNEIVQPPRPSSAAANQELMRSEFLL
PLGQNRAAPPSAGEPPHLSLVKVRVQHPKEASVKIHQVMKVKPVSGSSPAPRTLSSSSSG
SAGAPAQAPLPAGGARIQAQTLRGGGTYNPQSGFKYCFREVKDGQCSSPLPGLRSREVCC
RGIGKAWGLTDCSLCPEAPGQRNSSCPVGFERTNGTQCVDVNECLQPGLCENGICVNTRG
SYSCVCRLGFILDATHGICICTQSVISEEKGQCYRVLGSSRGPYTCSLPIVRNITKQICC
CSRVGKAWGPDCVRCPYFGSVAFKEICPAGPGYHYSASTLQRPSSSGSPSGTRTGPVQVQ
VPAQLGLTTSSRPTPPAGSATRNAQTRLEVQHGRSDIQNIRLDLALARPQPPLAFPSSVL
RPDPAPVPADSLPTPAPPRTSERGSRPGPEPPGPERRPAANPTNRPARVQPVRGVCQIRP
GVCERGRCVDLPGGKHTCECDEGFQPNAQRSRCFDVDECQQNPCSNGRCENSPGSFRCVC
YHGYRLAGNTCEESERCVCVWVCVCLPVGVFGCVCVCLPVCVCLPVCVPDVDECVDPLQC
PGQECVNMPGSYRCSPCQPGLGLLNGICTDIDECRLSPCSGGRCENTPGSFRCVCRHGYR
LQNNTCTDVDECAEPSQCPGQMCVNSVGSYRCVSCRPGYTLTNRQCTDLDECASAGACDA
EQVCVNSVGSFRCDCRPGYRSSGLGRRCTDVNECLEGDFCFSRGECVNTPGSYTCVCSPG
FRLSENRTACLDVDECVRPGVCSDGRCVNTDGSFLCQCNSGFSANPEQTACLDVDECVSS
GGSVCPSRRCENIIGSFRCLAACQAGQRVAADGSCVGPAVSAPASAAAATTFSLPAAPRL
PSSASVQRLSASPESGSRPESTHSSSSSSSGVQISAVDVPXCYYNLAAGGCSLLAANTSQ
QECCCTAGEGWGRGCRAHACPAPNTADFLSLCPSGWGYVTVGSSAFSYSDVDECKRFQPE
VCKNGVCVNNIPGYRCYCSSGFVYSSALLECIDYDECEEESCVGGECVNTVGSFYCSCPP
PLVVDDTQSNCVNASHLTRVLRNVDENLSVCWQHVSADLLCQSPLLGAQVTFIDCCCFYG
EGWGMGCALCPRTDSEEYASLCSSYSAAAFPGSFPDSGRPETGPGRGGFLIVSWFFQLPP
TVRSSFLQRRFLTSGSGLSATEDCGILHGCENGQCIRVAEGYTCDCYVGFELDLTSMSCI
DINECEDAAALPFPCINARCVNTEGSFRCVCRRGYVMSRRRNHC
Download sequence
Identical sequences M4AKH4
ENSXMAP00000014968 ENSXMAP00000014968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]