SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015484 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015484
Domain Number 1 Region: 94-146
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000225
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 616-675
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000274
Family Homeodomain 0.0031
Further Details:      
 
Domain Number 3 Region: 894-961
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000184
Family Homeodomain 0.0011
Further Details:      
 
Domain Number 4 Region: 293-355
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000154
Family Homeodomain 0.01
Further Details:      
 
Domain Number 5 Region: 769-826
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000471
Family Homeodomain 0.0029
Further Details:      
 
Domain Number 6 Region: 65-93
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000559
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000015484
Domain Number - Region: 975-1013
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000308
Family Homeodomain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015484   Gene: ENSXMAG00000015457   Transcript: ENSXMAT00000015507
Sequence length 1084
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556726.1:107630:116846:-1 gene:ENSXMAG00000015457 transcript:ENSXMAT00000015507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKRKSTTPCMIPSKVIRSVEEAERDSPVPVRHSRVSGGDRRSPLDASGDPKQEAGDAD
KDGGGGTYTCKLCNFETHDLNLFLDHVYTGHPDFRADPGFVCMSCGVSAPKFEGLALHNA
RVHPSTLNTTLQLRRRERRAVVEQNLVIGAELCRDSEISITKTPIMRMLKGKSEPKRIVV
SHSVSDEPASDVHSASISRESERKESSAVTVTHVSTIVHNGTSKTTLPSAIQIVNGSTGL
PLLKTPITQVVSVAQNRSLHHSASITASSTASSSSSSQNLPKVMIPLSSIPTYSASMDSS
SFLKTSFSKFPYPTKAELCYLTVVTKFPEEQIKIWFTAQRLKQGISWSPEEIEEARRKMF
NTIIQTAPVGSQNQTQSHHSQAPHTITVLPASLGPTGIPQFLQGSLVSPGGVIVTQPVVA
NGIQVSSAPVALAVTPKPQAAARPTMQARPAAALVADKSPSMLVGTVGSSKAMGGGTNST
SNTEGGVINLSLGSSSHSNAKGSSVNGKHGSANANSSEKNSSDVGSRVSARNTDKNKAVI
SSCENLKSKDANGSSNHNNLASAGTEEADPSGCDSPTIKMEDASSPASKSSSPTPAGPGS
SSGSRTPSSTFLDPSFYKGKKSQEQLSILKDSFLLSQWPDQEEVDRLIGLTGLTVREVRK
WFSDRRYHFRNCKSSRSSTGGQSKSSAGAGNGGGTPGSSAAAAAAAACNAPVDLSESSSS
NSGAKTPQHSSSTTTQSPPPTQTPTSPTAPSKRLFRLHSPDFTAVRYKERDPHQVIALEA
SFAQNTDPSGEEVDRLRSETKMTRREIHGWFAEKRKRVAAEKKKEEAERKPKEDEEEMEV
DGEERQRDDGSGEPKVNPIKINLKMLKVTEASSKAEGEGSGSTSSQKTSHSPKPTTVRGK
KTAEQLHLLKQVYARTQWPSATQYDELISGTGLPRPEVVRWFGDSRYVQKNGLLKWLEEY
QNLALEEELQRDGSKVLQDHLDAHGRLDDSQIKELAEKTGLTGDLVRHWFSTRGAIPDAK
QSAAQQAGTEAVAAEEAAAPPTGSSALEPQPGGGTEEKMEPSVCGAEADADSSAAATGSE
EASV
Download sequence
Identical sequences M4ALZ0
ENSXMAP00000015484 ENSXMAP00000015484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]