SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015628 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015628
Domain Number 1 Region: 192-392
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.59e-50
Family DBL homology domain (DH-domain) 0.000000138
Further Details:      
 
Domain Number 2 Region: 2-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.2e-37
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 379-542
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-30
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 
Domain Number 4 Region: 633-759
Classification Level Classification E-value
Superfamily SH2 domain 1.01e-23
Family SH2 domain 0.00086
Further Details:      
 
Domain Number 5 Region: 775-838
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-21
Family SH3-domain 0.00063
Further Details:      
 
Domain Number 6 Region: 589-661
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000746
Family SH3-domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015628   Gene: ENSXMAG00000015563   Transcript: ENSXMAT00000015651
Sequence length 844
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557074.1:331895:360983:-1 gene:ENSXMAG00000015563 transcript:ENSXMAT00000015651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCAMWLIECRVLPENHRVTLEGAQVCDLAQALRDGVLLCQLLNNLLPQAVNLREI
NLRPQMSQFLCLKNIRTFLAICQEKFYLKKNDLFEAFELFDVRDFGKVMNTLSILSHSHV
ALQRGLQPFPLEGCAADDEIYSGLSDQIDDTVDEDDDLYDFVEDEDNEGDEIYEDLMRTE
EPPETQQKVGVDKRECCLQEIQQTEEKYTATLDSILQHFMKPLEKFLQPHDIESIFINIK
ELAKTHRCLLEDVRNSILHLGAQNLYQVFINYKERLLLYGHYCSQVEAASKHLDKVSNSR
EDVRMKLEECSKRANSGRFSLRDLLMVPMQRVLKYHLLLQELLKHTTDAADKDNLRSGLD
AMRDLAQCVNEVKRDNEVIKQITSFQMSIENLTQSLALFGRPKIDGELKICSSEKKSKQD
RYAFLFDKAVVVCKKKSGETFELKDIIELHNYQIRDETTGEKDNKKWSYLFLLLDCFGRC
GYDFYFKTRELKKKWLEQFEMAMSNMCPENSTANNHDFQMHCFEETTSCKACSMLLRGTF
FQGYQCTRCKMAAHKECLGRVPGCGRNSDHSGNIKRQEKSHKNSGSSNTACPKMEVCQEY
YGLPPPPVGFGQPLQLFRGDIIELTRADVDLPWWEGRNLTAGQVGWFPCQKVQPYISRPT
PDLSDFLWFAGNMDRTAAKNLLISRSDGTFLVRQKDGGEFAISIKFNMDIRHIKITSCEG
LYRINDKKAFRGLIEMIEFYQKNSLKEYFKDVDTTLRIPFKQPEQSNSSNNTPHTTSGGS
IRSFGLARARYDFSARDRTELSLREGDTIKILKKGQTGWWKGEVYGRVGLFPSNYVEEDY
SDYC
Download sequence
Identical sequences M4AMD4
ENSXMAP00000015628 ENSXMAP00000015628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]